SecReT4
Protein ID: 225685407
T4SS name [ID]Tra_F [803]
Gene symboltraC
Locus tagPERMA_A0037
StrainPersephonella marina EX-H1
Repliconplasmid unnamed [GenBank: NC_012439] [Browse all T4SS(s) in this replicon]
Location [Strand]28176..30956 [-]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDC0QUW6
KEGG IDpmx:PERMA_A0037
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.5e-50, Aligned region: 469..768
TraC_F_IV [PF11130], Evalue: 1.2e-19, Aligned region: 42..268
Protein Sequence: 926 a.a.     [Download]
>gi|225685407|ref|YP_002729765.1| type-IV secretion system protein TraC [Persephonella marina EX-H1]
MITKIKELFLGENLEKYGTERRIINALIRNRVRAADYISVLEEKDNIFLTKEGFGFAFYLTLPAFLGQRQ
EEAFETFLNHDYPDGTVINFMAFSSSNIKPFLDYWEQEHSAENVDIDNPGILKYIIKKRKEYLLNAVNNS
FWEDVEAKPRIIYNIMSVHIPFESDNPDVVRIQFRRIRKLANRIREAIRAEGFGCDFANADMMLAIYKEI
LNPELQGAIKYQKGLDFNRQVLDRNTTLRLVGGLESDLEVANDEKKKYWRGFWFSQYPNEMTLWKFSNIL
FPYDDTNPSPIIPTDFFMCMQVKVEDIEKRQTKITAKAIQMQDQAEKSEFARWIPKIKRRGEYAKYIKEV
IEDGKVPYSASMYLFISADNPEHLDDIASGAVQRFVSKKFKLAREIDASLFNVLMECLPLNQIKEREEFF
INYSTLFDANIASLMPFQGTSLGSKRPITLYLDRKYSLWGFDPFHSDTNFNIVKIAASGGGKSFSENDFH
VLNLSAGRKIRVIDIGWSYKPLCSLLGGEYIELDDERNPCFNPFTHIIEDEKGNIHEDELAVLIPFVGLL
AGLDLNPEALISNEDNLMARYCSFIARAITNAYKSYGNKTGLKEVVEELQKLEDDTGDNIPQKLSQALYE
FSHGHYARYFNGENNIHYSKDYVVLELEQIENKDPRLKQAILYSLILRIFREFFLAHLRKDYSRKFLVVD
EAWSILRESKAGYFLETAARRFRKYGCSLVVITQKIEDLLASPATRAIYANSAHLMILKPSEQDIEDAKS
EKRLPVSDFEKELILSLTTVPGKFSELIIRNSVLGTVVGRLIVDRYSYWTFTTNDAERRVRTELLEELKN
YELVLETLAKRMPIGEILEKLGYITGEQKQLILWLQSNHPKYKGKLFGEIATELGFVSKEKVIEATEKQK
NISLQLKQLVEAYKKK
 
Nucleotide Sequence: 2781 bp     [Download]
>gi|225685337|ref|NC_012439.1|:c30956-28176 Persephonella marina EX-H1 plasmid unnamed, complete sequence
ATGATAACTAAAATCAAGGAGCTGTTTTTAGGGGAAAATTTAGAAAAATACGGAACTGAAAGAAGAATAA
TTAATGCTTTGATAAGAAACAGGGTAAGAGCCGCAGACTATATTTCTGTTTTGGAAGAAAAAGACAATAT
ATTTCTGACCAAAGAAGGTTTTGGCTTTGCATTTTACTTGACACTTCCAGCTTTTCTTGGGCAAAGACAG
GAAGAAGCCTTTGAGACATTCTTGAACCATGATTATCCAGACGGAACGGTAATAAACTTTATGGCTTTTT
CATCTTCAAACATAAAGCCGTTTTTGGATTATTGGGAACAGGAGCATAGTGCTGAAAATGTAGATATAGA
TAACCCCGGTATTCTGAAGTATATAATCAAAAAAAGAAAAGAATACCTGCTAAATGCTGTAAATAATAGC
TTTTGGGAAGATGTAGAGGCAAAGCCAAGGATAATATACAACATCATGTCGGTTCATATTCCTTTTGAAA
GCGATAATCCTGATGTGGTTAGGATACAATTCAGGAGAATAAGGAAACTTGCAAACAGAATAAGGGAAGC
AATAAGGGCAGAAGGTTTCGGATGCGATTTTGCAAATGCTGATATGATGCTTGCAATTTACAAAGAGATA
TTAAATCCAGAACTTCAAGGAGCTATTAAATATCAAAAGGGGCTTGATTTTAATAGACAGGTTCTTGACA
GAAACACAACACTACGGCTTGTAGGTGGGCTGGAAAGTGATTTAGAGGTTGCAAATGATGAGAAAAAGAA
ATACTGGAGAGGCTTCTGGTTTAGCCAGTATCCAAATGAAATGACATTGTGGAAATTTTCCAATATTTTG
TTTCCTTATGATGATACTAATCCAAGTCCGATTATACCCACTGATTTTTTCATGTGTATGCAGGTCAAGG
TAGAAGATATAGAAAAAAGGCAAACGAAAATAACCGCAAAAGCTATTCAAATGCAAGACCAAGCTGAAAA
ATCAGAGTTTGCAAGATGGATACCAAAGATAAAAAGAAGGGGAGAGTATGCCAAGTATATAAAAGAAGTT
ATAGAAGATGGTAAAGTTCCTTATAGTGCTTCCATGTATCTGTTTATAAGTGCAGATAACCCAGAGCATT
TAGATGATATAGCCTCTGGAGCTGTTCAAAGATTTGTTTCAAAGAAATTTAAGCTTGCAAGGGAAATAGA
TGCCTCACTTTTCAATGTATTGATGGAATGTTTACCCTTAAACCAGATAAAAGAAAGAGAAGAATTTTTT
ATTAACTATTCCACTTTGTTTGATGCAAATATAGCTTCCTTAATGCCATTTCAAGGGACAAGTTTAGGTT
CTAAAAGACCAATAACTCTATATCTGGATAGGAAATACAGCCTTTGGGGATTTGACCCTTTTCATTCAGA
CACAAATTTCAATATCGTAAAGATAGCCGCTTCTGGTGGTGGTAAATCTTTCTCGGAAAATGACTTCCAC
GTGCTTAATCTGTCAGCTGGTAGAAAAATAAGAGTTATAGATATAGGATGGTCCTATAAACCACTTTGTA
GTCTTTTAGGTGGTGAGTATATAGAACTTGATGATGAGAGAAACCCTTGTTTTAATCCATTTACTCATAT
TATTGAAGATGAAAAAGGAAATATCCATGAAGATGAACTTGCCGTATTAATCCCATTTGTCGGACTACTT
GCAGGTTTAGATTTAAATCCTGAAGCTCTCATATCAAATGAAGATAACTTAATGGCAAGATATTGTTCAT
TCATAGCAAGGGCTATTACAAATGCTTATAAAAGCTACGGCAACAAAACAGGTCTGAAAGAAGTAGTTGA
GGAACTGCAAAAACTTGAAGATGATACTGGAGACAATATTCCACAAAAACTATCTCAAGCCTTGTATGAG
TTTTCACATGGGCATTATGCAAGATATTTCAATGGTGAAAATAATATCCACTATTCAAAGGATTATGTTG
TATTAGAACTTGAACAGATAGAAAACAAAGACCCAAGGCTAAAACAGGCTATTCTTTATTCATTAATACT
ACGGATATTTAGAGAATTTTTCCTTGCACATTTAAGGAAAGACTACTCAAGAAAATTCCTTGTCGTTGAC
GAGGCGTGGTCAATTTTAAGAGAGAGCAAAGCTGGATATTTCCTTGAAACAGCTGCAAGAAGATTTAGAA
AGTATGGTTGTTCTCTTGTAGTTATTACACAGAAAATAGAGGACTTGCTTGCTTCTCCAGCGACAAGGGC
AATATATGCAAACTCTGCACATCTTATGATACTAAAGCCTTCGGAACAGGATATTGAGGATGCAAAGAGT
GAAAAAAGGCTTCCTGTATCTGATTTTGAAAAGGAACTGATACTATCTCTTACTACCGTTCCAGGGAAGT
TTTCGGAGTTAATCATAAGAAACTCTGTTCTGGGAACTGTTGTAGGTAGGTTAATAGTTGACAGATACTC
ATACTGGACATTTACGACGAACGATGCTGAAAGAAGAGTTAGAACCGAATTATTGGAAGAATTGAAAAAC
TATGAGCTTGTTCTGGAAACACTGGCTAAAAGAATGCCGATAGGGGAGATACTGGAAAAACTTGGATACA
TTACTGGAGAACAAAAACAGCTAATTTTATGGCTTCAATCCAATCATCCAAAATATAAGGGTAAGCTATT
TGGAGAAATAGCTACTGAACTTGGGTTCGTCAGCAAAGAAAAGGTTATAGAAGCAACAGAAAAACAAAAA
AACATATCACTCCAGCTAAAACAACTTGTAGAAGCCTATAAGAAGAAGTAG
 Primer design