SecReT4
Protein ID: 225685927
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0064
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]57894..59045 [-]
Producttype IV secretion system protein virB10
Component typeVirB10
UniProt IDC0RK12
KEGG IDbmi:BMEA_B0064
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-61, Aligned region: 196..374
Protein Sequence: 383 a.a.     [Download]
>gi|225685927|ref|YP_002733899.1| type IV secretion system protein virB10 [Brucella melitensis ATCC 23457]
MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQ
TSTVPMRTFKLPPPPPPPPPPPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVV
TKSSGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTR
LDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGA
DPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTI
NIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c59045-57894 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGACACAGGAAAACATTCCGGTGCAGCCGGGCACACTTGACGGTGAGCGTGGCCTACCCACCGTGAACG
AAAACGGCTCCGGCCGCACCCGCAAGGTGTTGCTCTTTCTCTTTGTCGTGGGCTTCATCGTCGTGCTGCT
GTTGCTGCTCGTGTTTCACATGAGGGGCAATGCAGAGAATAATCACCATTCAGACAAGACGATGGTGCAG
ACCAGCACAGTTCCGATGCGAACTTTCAAGCTGCCACCCCCGCCACCCCCGCCACCCCCGCCACCACCAG
AACCACCAGCCCCGCCACCGGCCCCAGCCATGCCCATCGCGGAACCCGCAGCGGCGGCGCTGAGCCTGCC
ACCATTGCCGGATGATACGCCGGCAAAGGACGATGTACTGGACAAGTCGGCCAGCGCGTTGATGGTCGTC
ACCAAGTCCAGCGGCGATACGGTCGTTCAAACGACCAATGCGCGCATTCAAGCCCTGCTCGACAGTCAAA
AGAACACCAAGCAGGATGCTGGATCGCTGGGTACTCTCCTTCACGGCACACAAACGGATGCACGCATGGC
GAGCCTTCTGCGCAACCGTGATTTCCTGCTCGCGAAGGGCAGCATCATCAATTGCGCGCTGCAAACCCGT
CTGGATTCGACGGTGCCGGGCATGGCTGCCTGCGTGGTCACACGCAACATGTATAGCGATAACGGCAAGG
TGTTGCTGATTGAGCGCGGTTCAACCATCTCGGGTGAATATGATGCCAACGTAAAGCAGGGCATGGCTCG
CATTTATGTCCTGTGGACGCGCGTGAAGACGCCGAACGGTGTCGTGATCGATCTCGACTCTCCAGGCGCC
GACCCCCTGGGCGGGGCAGGCTTGCCCGGCTACATCGACTCCCACTTCTGGAAGCGCTTTGGCGGCGCCT
TGATGTTGAGCACGATCGAGACCCTCGGCCGCTATGCAACCCAGAAGGTCGGCGGCGGGGGTTCAAATCA
GATCAACCTCAATACCGGCGGAGGTGAATCGACGAGCAACCTGGCTTCAACTGCCTTGAAGGATACGATC
AACATTCCGCCGACACTGTACAAGAACCAGGGCGAAGAGATCGGCATCTATATCGCCCGCGACCTAGATT
TTTCGAGTGTGTATGATGTCAAACCGAAGTGA
 Primer design