SecReT4
Protein ID: 225685928
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0065
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]59042..59911 [-]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDC0RK13
KEGG IDbmi:BMEA_B0065
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-64, Aligned region: 29..259
Protein Sequence: 289 a.a.     [Download]
>gi|225685928|ref|YP_002733900.1| P-type conjugative transfer protein VirB9 [Brucella melitensis ATCC 23457]
MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVLVRALPGVGARIVFAPGENIEDVASGF
TQGWEFKASHNILYLKARSMTLSHSNQSIDMAPEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRV
QFRYPAAAAAAAVAAAQKRVVQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFP
AAFLVAEDKSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPGVKRV
IKSPGENLQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c59911-59042 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGAAAAGATTCCTGCTTGCGTGCATACTGATCACGCTGGCCTCGCCCTCCTGGGCAACCAAAATCCCGT
CCGGCTCAAAATACGACAGCCGAATTCAGTATGTCGATTACAATTCCGGCGATGTCGTGCTGGTTCGGGC
CCTGCCCGGCGTTGGCGCACGCATCGTGTTTGCGCCGGGCGAGAATATTGAGGATGTCGCCTCAGGATTT
ACGCAAGGCTGGGAGTTCAAGGCGAGCCACAACATCCTGTATCTCAAGGCCCGCTCCATGACGCTCTCCC
ACTCGAACCAATCGATCGACATGGCCCCGGAACCGGGCAAGTGGGACACAAACCTGATGGTCACGACAGA
TCAGCGCATGTACGATTTCGATTTGCGCTTGATGCCCGGCCGCAACAATCAGCGTGTTGCCTATCGTGTT
CAGTTCCGCTACCCGGCGGCAGCGGCAGCGGCGGCAGTAGCAGCCGCGCAAAAGCGAGTGGTACAGGCCC
GCATGAATGCCAGACCGTCGCCGGTAAACTGGAACTACACGATGCAGGTCGGCACTAATTCGGCCAGCAT
CGCGCCCACTCTTGCCTATGACGATGGGCGGTTCACATATTTGCGCTTTCCGAACAACAGAGACTTTCCG
GCCGCTTTCCTTGTCGCCGAAGACAAGTCGGAAAGCATCGTGAACAGCCATATAGACCCGTCAGCGCCGG
ACATTCTGGTCCTGCATCGGGTCGCAAAGCAAATGGTGCTGCGCCTCGGTAACAAGGTGATTGGCATCTA
CAACGAATCCTTCAATCCTGATGGCGTTCCCGCACGCGACGGAACCACAGTGCCAGGCGTCAAGCGCGTC
ATCAAATCGCCCGGGGAGAACCTGCAATGA
 Primer design