SecReT4
Protein ID: 225685929
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0066
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]59908..60627 [-]
Producttype IV secretion system protein virB8
Component typeVirB8
UniProt IDC0RK14
KEGG IDbmi:BMEA_B0066
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-64, Aligned region: 26..234
Protein Sequence: 239 a.a.     [Download]
>gi|225685929|ref|YP_002733901.1| type IV secretion system protein virB8 [Brucella melitensis ATCC 23457]
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQ
HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQS
YASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPS
LMSESARLTNPLGFNVTSYRVDPEMGVVQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c60627-59908 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGTTTGGACGCAAACAATCTCCACAGAAATCAGTAAAGAACGGGCAGGGCAATGCGCCTTCGGTATATG
ACGAAGCGTTGAACTGGGAGGCCGCGCACGTCCGGCTGGTCGAAAAATCCGAACGCCGCGCGTGGAAAAT
CGCCGGGGCTTTCGGCACCATTACCGTGCTGCTCGGGATCGGCATCGCCGGGATGTTACCGCTAAAGCAA
CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGA
AGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTA
CGACTGGTACACGCTGCAAAAGGACTACGAAACCGTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGC
TATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAATATGGCTCAAATGTGCGCACATCGGTAA
CGATCGTAAGCATCGTGCCGAACGGCAAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCAC
CAACGAGACCGGTGATGGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCT
TTGATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGATCCAG
AAATGGGAGTGGTGCAATGA
 Primer design