SecReT4
Protein ID: 225685930
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0067
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]60630..60803 [-]
ProductTraI protein
Component typeVirB7
UniProt IDC0RK15
KEGG IDbmi:BMEA_B0067
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|225685930|ref|YP_002733902.1| TraI protein [Brucella melitensis ATCC 23457]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c60803-60630 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design