SecReT4
Protein ID: 225685931
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0068
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]60967..62010 [-]
Productprotein virB6
Component typeVirB6
UniProt IDC0RK16
KEGG IDbmi:BMEA_B0068
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-47, Aligned region: 42..269
Protein Sequence: 347 a.a.     [Download]
>gi|225685931|ref|YP_002733903.1| protein virB6 [Brucella melitensis ATCC 23457]
MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGPFSQLVISCIK
FMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRG
LTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIV
TSILQVALLSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISA
ATISLGSLAVNTAKSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c62010-60967 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGGTTAATCCTGTAATCTTTGAGTTCATCGGCACTTCGATCCACAACCAGTTGAACAATTACGTGACTA
TGGTGGCATCCAACACCATGAATATGATTGCCACGACTGCTGTCCTCGCCGGTGGCCTCTACTATACCGC
CATGGGCATATTGATGTCTGTGGGGCGGATCGAAGGGCCGTTTTCGCAACTCGTCATAAGCTGTATTAAA
TTCATGCTGATTGCTGCTTTTGCGCTCAATATCAGCACCTATTCGGAGTGGGTGATCGATACGGTGCACA
ACATGGAGTCCGGATTTGCCGACGCCTTTGCCGGCAATCACGGCACCCCTTCCAGCACGATCTACCAGAC
CCTCGACAATTCGTTGGGCAAGGGGTGGAACATCGCAGCCATGCTCTTTGAGAAAGGCGATAATCGCGGC
CTGACCCAGATCGTGCAGGGCTTTTCAGAACTGTTACTGTCATTCCTGGTAGCCGGCTCAACGCTTATCC
TTGCAGGCCCGACTGGTGCGATGATCGTCGCAACCAATGCGGTGATCGCGATCCTGCTCGGAATCGGCCC
TCTCTTCATCCTCGCCCTTGGCTGGGCGCCGACAAGGGGCTTCTTCGATCGCTGGTTCGGGGCCATCGTC
ACATCGATCCTTCAGGTCGCGCTTTTGTCGGCCGTGCTATCTATATCGAGTGCAATCTTCAGCCGCATGG
TGGCGGCCATCAATTTGGCTTCCGCAACACAAAGCACGCTCTTTTCCTGCCTCTCACTGACCGCTGTAAC
GATTGTCATGCCGTATATGATGTACAAGGTCTATGAATACGGTGGCATCCTGGGCAGCAGCATATCGGCG
GCCACGATCTCCCTCGGCTCACTTGCAGTCAATACCGCGAAATCTGGTGGTGGCGCTATGACGAGCATAT
TCAGCGGATCATCCGGCGGCGGGGGTTCCGGCTCGGCGAAGGCGGGCGGGGAAAGCAGTTATTCGGCTGG
TGGCAACGCCATGTGGAGCCCGGCTTACCGGCAACACGTGCTCGGCCAGTTCAACAGGGATTAG
 Primer design