SecReT4
Protein ID: 225685932
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0069
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]62194..62910 [-]
ProductP-type DNA transfer protein VirB5
Component typeVirB5
UniProt IDC0RK17
KEGG IDbmi:BMEA_B0069
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.2e-66, Aligned region: 21..217
DUF4141 [PF13605], Evalue: 8.4e-07, Aligned region: 1..43
Protein Sequence: 238 a.a.     [Download]
>gi|225685932|ref|YP_002733904.1| P-type DNA transfer protein VirB5 [Brucella melitensis ATCC 23457]
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRG
LGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPV
QDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKL
LDERQHELDAKDNARRGYPQPKALEAAY
 
Nucleotide Sequence: 717 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c62910-62194 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGAAGAAGATAATTCTCAGCTTCGCATTCGCCCTGACTGTAACCAGCACGGCGCACGCACAGCTCCCGG
TGACAGATGCCGGCTCCATCGCGCAGAACCTGGCCAACCATCTCGAACAGATGGTGAAGTTCGCCCAGCA
GATCGAGCAACTGAAACAGCAGTTTGAACAACAGAAAATGCAGTTCGATGCCCTGACCGGCAACCGTGGC
CTTGGCGATATTCTCCGCGACCCTACGCTGCGTAGCTATCTGCCACATAACTGGCGAGATCTCTACGAAG
CGGTGATGAGCGGCGGCTACCTGGCGGCGGCTGGCGAAACGGCCAACCTCTTACGCAAAAGCCAGGTATA
CGATCCGTGTGCCTCCATCTCCGACAAAGATCAGCGCATCGCATGTGAGGCTAAAGTGGTGAAGCCGGTC
CAGGACAAGGTCATGACGTCCAAAGCCTACGACGCCACTGACAAACGCCTACAAGAGATCGAGAGCTTGA
TGCAGGAGATCAACAAGACGGGAGACCCGAAGGCGATTGCCGAATTGCAAGGCCGGATCGAAAGCGAAAA
TGCCATGATCCAAAACGAAGACACCCGCCTTCATCTCTACCAGCAGATGGCAGAGGCACAGGACAAGCTC
CTGGACGAACGCCAGCACGAATTAGACGCGAAGGATAATGCCCGGCGCGGCTATCCGCAGCCGAAAGCAC
TGGAAGCCGCCTATTAA
 Primer design