SecReT4
Protein ID: 225685933
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0070
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]62915..65410 [-]
Producttype IV secretion/conjugal transfer ATPase, VirB4 family protein
Component typeVirB4
UniProt IDC0RK18
KEGG IDbmi:BMEA_B0070
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.4e-72, Aligned region: 184..388
AAA_10 [PF12846], Evalue: 7.6e-24, Aligned region: 452..744
Protein Sequence: 831 a.a.     [Download]
>gi|225685933|ref|YP_002733905.1| type IV secretion/conjugal transfer ATPase, VirB4 family protein [Brucella melitensis ATCC 23457]
MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFR
AIASNNVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFN
VAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSG
EWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTASATRYARGIDFKDYANHTEPGILNGLMYSDYEYVITQ
SFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNT
SHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQAL
TLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF
DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAI
RTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQIDFNTHSN
YGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRKQNGLGV
FATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHS
MICRLELNGFDDELAILSGSSDNNELLDQVIAEVGDDPSVWLPVFQERRKARIASSKSTGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c65410-62915 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGGGCGCTCAATCCAAATACGCGCAACAGCTCAATAATGAACGGTCACTTGCACCGTTCATTCCCTTCA
GGAGCCAGGTTGGCCCGACCACCGTGATAACGCGTGACGGTGATTTCGTGCGCACATGGCGCATCGCGGG
CCTGGCTTTCGAGACGCAGGACAAGGAGAAACTGTTGATCCGCAAGGACCAGCTTAACACCTTGTTCCGT
GCCATCGCCTCAAACAATGTGGCGCTGTGGTCCCACAACGTACGGCGCAGAACCTGGGATCACTTGAAAT
CCTTCTTTTCCAATCCGTTCTGCGACGCTCTCGACAAGAAGTATTACGGATCGTTTTCCGGCTACCGAAT
GATGTCAAACGAACTGTATCTGACGGTTATTTACCGGCCAGTGCCGGCGAAGATCAGCAGGTTGTTCAAC
GTGGCCGTTCATCGTTCGCATGCGGAAATCTTACAGGAGCAGCAGCTTGCCATCCGCAAGCTGGACGAAA
TCGGCAATCAAATTGAAACCAGCTTGCGTCGCTACGGTGGCGATGACGGGCGTGGCATCGAAGTGCTGAG
CACCTATGAGGACAAACACGGCGCACTGTGCTCACAGCAGCTTGAATTTTATAACTTCCTTCTCTCAGGC
GAATGGCAGAAGGTGCGCGTGCCATCCTGCCCACTGGATGAATATCTGGGCACCGGGTGGGTGTATGCTG
GCACTGAAACCATCGAGATACGCACCGCGAGCGCGACGCGCTATGCGCGTGGCATCGATTTCAAGGACTA
TGCGAACCACACCGAGCCGGGCATTTTGAACGGCCTGATGTATAGCGATTACGAGTACGTCATCACACAA
TCCTTCAGCTTCATGACAAAGCGGGATGGCAAGGAGTTCCTGACACGGCAAAAGCAGCGGCTCCAAAATA
CCGAAGACGGCAGCGCATCCCAGATCATGGAAATGGACATTGCCATCGACCAGCTCGGCCGGGGCGATTT
CGTCATGGGTGAATATCATTATTCGCTGCTGGTATTTGCCGAAGACATGGAGACGGTGCGCCACAACACA
TCACATGCGATGAACATCCTGCAAGACAATGGTTTTCTGGCGACGGTGATCGCCACGGCCACGGATGCGG
CGTTCTATGCACAACTGCCATGTAACTGGCGGTATCGGCCGCGCGTGGCGGGCCTGACCTCGCTCAACTT
CGCCGGTCTGTCATGTTTCCATAATTTCCGCGCAGGCAAGCGGGATGGCAACCCCTGGGGGCAGGCATTG
ACGCTGCTCAAAACCCCTTCCGGACAGCCCGCCTACCTGAACTTCCACTATTCAAAAGGCGACGAAGACA
ACTTCGACAAGAAGCTTCTGGGCAATACCCGCATCATCGGCCAGTCCGGCGCTGGTAAAACTGTCCTGAT
GAACTTCTGCCTCGCGCAAGCGCAGAAGTATTTGCACAATGCTCCGATGGGTATGTGCAACGTCTTTTTC
GACAAGGATCAAGGCGCGAAAGGGACTATTCTTGCCATTGGCGGCAAATACCTTGCCATCAGGAACGGCG
AACCCACCGGGTTCAACCCATTCCAGATGGAGCCAACAGCGGGGAACATCCTGTTCCTTGAAAAACTCGT
ACAGGTACTGGTATCGCGTGATGGCCAGCACGTGACCACAACGGACGAAAGCCGGATCAGTCATGCCATA
CGTACGGTCATGCGCATGCGCCCGGAGCTGCGGCGTCTGTCGACGGTGCTGCAAAACGTTACCGAAGGCA
GCGACCGCCAAGATCGTGAAAACAGCGTGGCGAAGCGGCTCGCGAAGTGGTGTTTTGATGACGGCACCGG
CAAGCGGGGCACATTCTGGTGGGTGCTGGATTGCCCGCAAGACCAGATCGACTTCAACACGCATAGCAAT
TACGGTTTCGATGGCACCGACTTCCTCGACAACGCCGACGTGCGTACGCCGATTTCCATGTACCTGCTGC
ATCGTATGGAATTGGCTATCGACGGGCGTCGTTTCATCTACTGGATGGACGAGGCGTGGAAGTGGGTAGA
CGACGAAGCATTCAGCGAGTTCGCCAATAACAAGCAGCTTACCATCCGCAAGCAAAACGGCCTGGGCGTG
TTTGCCACGCAAATGCCCTCCAGCCTGCTCAACTCCAAAGTCGCGTCGGCCCTGGTGCAACAGGTGGCGA
CGGAAATCTATCTGCCGAATCCGAAAGCCGATTATCACGAGTACACGGACGGCTTCAAGGTGACGAACGA
GGAGTTCGACATCATCCGCAGTATGAGCGAGGAAAGCCGCATGTTCCTGGTCAAGCAGGGGCATCATTCG
ATGATTTGCCGCCTGGAGCTTAATGGCTTTGATGACGAACTGGCGATCCTCTCAGGCAGCTCGGACAACA
ACGAGTTGCTGGACCAGGTCATTGCCGAAGTCGGGGACGACCCTTCGGTATGGCTTCCGGTGTTCCAGGA
GCGCCGGAAAGCACGCATTGCGTCGTCCAAATCAACAGGAAGGTGA
 Primer design