SecReT4
Protein ID: 225685934
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0071
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]65410..65760 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDC0RK19
KEGG IDbmi:BMEA_B0071
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-29, Aligned region: 10..102
Protein Sequence: 116 a.a.     [Download]
>gi|225685934|ref|YP_002733906.1| type IV secretory pathway VirB3 family protein [Brucella melitensis ATCC 23457]
MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQI
TQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
 
Nucleotide Sequence: 351 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c65760-65410 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGACAACGGCACCACAGGAATCCAACGCACGAAGCGCAGGTTATCGCGGCGATCCAATATTCAAGGGCT
GTACACGGCCAGCCATGTTGTTTGGGGTTCCTGTGATCCCGCTTGTCATCGTTGGCGGCAGCATCGTTCT
CTTATCGGTCTGGATTTCCATGTTCATATTGCCGCTGATCGTACCAATCGTGCTGGTCATGCGGCAGATC
ACGCAGACTGACGATCAGATGTTCCGCCTGCTCGGCCTGAAGGCGCAATTCCGCCTGATCCACTTCAACC
GCACCGGGCGCTTCTGGCGGGCATCCGCCTATAGCCCGATTGCCTTCACAAAGCGCAAAAGAGAATCATA
A
 Primer design