SecReT4
Protein ID: 225685935
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0072
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]65774..66091 [-]
Productconjugal transfer protein TrbC
Component typeVirB2
UniProt IDC0RK20
KEGG IDbmi:BMEA_B0072
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-21, Aligned region: 7..103
Protein Sequence: 105 a.a.     [Download]
>gi|225685935|ref|YP_002733907.1| conjugal transfer protein TrbC [Brucella melitensis ATCC 23457]
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSG
YKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c66091-65774 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGAAAACCGCTTCCCCCAGCAAGAAGTCGCTGTCGCGGATTCTACCTCACCTACTGCTGGCCCTCATTG
TCTCCATCGCTGCAATCGAGCCTAACCTGGCGCACGCCAACGGTGGCCTCGATAAGGTAAATACAAGCAT
GCAAAAAGTGCTGGACTTGCTAAGCGGCGTATCGATCACCATCGTTACCATAGCCATCATCTGGTCCGGT
TACAAGATGGCATTCCGGCACGCCCGCTTCATGGATGTAGTGCCGGTGCTGGGCGGCGCCCTGGTGGTTG
GCGCTGCCGCCGAAATTGCCTCTTACCTGCTTAGGTAA
 Primer design