SecReT4
Protein ID: 225685936
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0073
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]66527..67243 [-]
ProductLytic transglycosylase catalytic
Component typeVirB1
UniProt IDC0RK21
KEGG IDbmi:BMEA_B0073
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.7e-20, Aligned region: 5..136
Protein Sequence: 238 a.a.     [Download]
>gi|225685936|ref|YP_002733908.1| Lytic transglycosylase catalytic [Brucella melitensis ATCC 23457]
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLEAKGWNFSLGI
AQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTK
PGSPSYVQKVVASADVTTKPIVVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAAN
APVRLKTEQPATTDAPPGKDNTDGVVVF
 
Nucleotide Sequence: 717 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c67243-66527 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGGTGCCATTCCTTGTCCTCGCGCAACAATGCGCACCGACTGTTGCACCTCAGACTATGGCAGCAATCG
TGCAGGTCGAGTCGGGCTTCAATCCTTATGCAATAGGCGTCGTTGGTGGGCGGTTGGTCCGTCAACCCGT
TTCCCTTGATGAAGCAATCACGACAGCACAGTCACTGGAAGCCAAAGGCTGGAATTTCTCTTTGGGTATT
GCTCAAGTCAACAGGTACAATCTGCCGAAATATGGCAGCACCTACGCACAAGCGTTCGACCCCTGCAAGA
ACCTGAAGATGGGATCCAAGATCCTTGAAGACTGCTACCGTCGGGCCATCGTGAAGATGCCCGGTCAGGA
ACAAGGCGCGCTTCGCGCCGCATTCTCCTGTTACTACGCCGGCAACTTTACGGGCGGCTTCAAGACGAAG
CCCGGCAGTCCCAGCTACGTGCAGAAGGTCGTGGCAAGCGCCGACGTGACCACAAAGCCGATTGTTGTCG
TGCCCATGATCCGGAAAACGCCGGATGCGGCGGCAGCAGTAGCTGCCCCAGTAAAAAAACGACAGCCGGC
TGATCGTAATTCTGTTCTTGTCGATCTGCATCCATCATCGCAGTCGATGCCAGCCACCGGCGCGGCGAAC
GCGCCTGTAAGGCTGAAGACAGAGCAGCCGGCGACAACCGATGCGCCGCCAGGGAAGGATAATACGGACG
GCGTAGTTGTTTTCTAA
 Primer design