SecReT4
Protein ID: 225856795
T4SS name [ID]Tra_Tn [662]
Gene symbol-
Locus tagSPP_1161
StrainStreptococcus pneumoniae P1031
Repliconchromosome [GenBank: NC_012467] [Browse all T4SS(s) in this replicon]
Location [Strand]1081408..1081914 [-]
Productconjugative transposon membrane protein
Component typeOrf17_Tn
UniProt IDC1CKL8
KEGG IDspp:SPP_1161
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 4.2e-34, Aligned region: 44..145
Protein Sequence: 168 a.a.     [Download]
>gi|225856795|ref|YP_002738306.1| conjugative transposon membrane protein [Streptococcus pneumoniae P1031]
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFT
QMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTY
AEKKVTLGRNQPQEAITAVRSEFYGISN
 
Nucleotide Sequence: 507 bp     [Download]
>gi|225855735|ref|NC_012467.1|:c1081914-1081408 Streptococcus pneumoniae P1031, complete genome
ATGGGATTTTTGAAATCGTCTATTAAATCTGTCGGTACATTACTACTGGCAGATTTTCTATTTTACGGGG
TGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCAG
TATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTACG
CAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATGA
TAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTTT
TGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTAT
GCAGAAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTT
ATGGCATATCCAATTAA
 Primer design