SecReT4
Protein ID: 225872823
T4SS name [ID]Trb [794]
Gene symbol-
Locus tagACP_1182
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]1392532..1392870 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDC1F4R1
KEGG IDaca:ACP_1182
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.3e-14, Aligned region: 18..109
Protein Sequence: 112 a.a.     [Download]
>gi|225872823|ref|YP_002754280.1| hypothetical protein ACP_1182 [Acidobacterium capsulatum ATCC 51196]
MNPISSSTAHCCHRWLRWLRRIRESVTLFSLLVLFPTLAAAQTASPFDTGFNALQNLFTGTIARVASLIA
IVIGGYSFAHGEPGAKRTLAGVVAGTGIAVLAANVLSWLWGV
 
Nucleotide Sequence: 339 bp     [Download]
>gi|225871699|ref|NC_012483.1|:1392532-1392870 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGAACCCCATTTCCTCTTCTACCGCGCACTGTTGCCATCGTTGGCTCAGGTGGCTGCGCCGAATCCGCG
AATCCGTCACGCTTTTCTCTCTGCTCGTCTTGTTCCCGACCTTGGCGGCTGCCCAAACCGCCTCGCCGTT
TGATACGGGATTCAATGCCCTGCAAAACCTCTTCACAGGAACGATTGCCCGAGTGGCCAGCCTGATCGCC
ATTGTGATTGGCGGCTATAGTTTCGCTCACGGAGAGCCCGGTGCGAAGCGCACACTGGCGGGCGTAGTGG
CTGGAACGGGCATCGCCGTACTCGCCGCCAACGTACTGAGCTGGCTTTGGGGAGTTTGA
 Primer design