SecReT4
Protein ID: 225872826
T4SS name [ID]Trb [794]
Gene symbol-
Locus tagACP_1185
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]1395732..1396496 [+]
Productconjugal transfer protein
Component typeTrbG
UniProt IDC1F4R4
KEGG IDaca:ACP_1185
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.2e-29, Aligned region: 27..252
Protein Sequence: 254 a.a.     [Download]
>gi|225872826|ref|YP_002754283.1| conjugal transfer protein [Acidobacterium capsulatum ATCC 51196]
MKRILIFAAGFVLALSSATAHAQDFSARTVQYHSQDIVPIHAKLRYTTLIELPPTEKIMEAAVGDKDFWI
VNVVGNLCFVHPAKAGIKSDLNLITDKGNIYSFTLQEVSGTKLKPDLKVIIHPAGRSSIIAADGPPQFVP
AAQLKQAKEEVTALESHITQTIDQYKAAYPLSLKFDYKFRANASPFDIEAIYHDKRFTYIKTDAPEKFSV
YDLRDGKPNLVTYQLEKGTYIIPEVMDSGYVQFGKKRMNFSRKG
 
Nucleotide Sequence: 765 bp     [Download]
>gi|225871699|ref|NC_012483.1|:1395732-1396496 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGAAACGCATACTCATCTTCGCCGCTGGATTCGTTCTGGCTCTTTCTTCCGCCACCGCGCATGCCCAGG
ATTTCTCGGCGCGAACCGTTCAATACCACTCACAGGACATTGTTCCGATTCACGCCAAGCTCAGATATAC
GACTCTGATCGAGCTGCCGCCGACCGAGAAGATCATGGAGGCAGCGGTGGGAGACAAGGATTTCTGGATT
GTGAACGTGGTGGGTAATCTCTGTTTTGTTCATCCCGCGAAAGCCGGAATCAAATCGGACCTGAATCTCA
TTACGGACAAGGGAAATATCTATTCCTTCACGCTCCAGGAGGTATCGGGGACGAAGCTCAAGCCGGACTT
AAAGGTCATCATTCACCCCGCCGGTCGCTCGTCGATCATAGCCGCCGACGGCCCTCCGCAGTTTGTGCCG
GCGGCGCAACTGAAGCAGGCCAAGGAAGAGGTAACGGCACTTGAATCCCACATCACCCAAACCATCGACC
AGTACAAAGCGGCCTATCCGCTGTCTCTGAAGTTCGACTACAAATTCCGCGCCAATGCGTCCCCGTTTGA
CATCGAAGCCATCTACCACGACAAGCGATTCACCTATATCAAGACCGACGCGCCGGAGAAATTCTCCGTC
TACGACCTGCGTGACGGAAAACCCAATCTTGTGACGTATCAGCTTGAGAAGGGAACCTACATTATTCCCG
AGGTGATGGATTCGGGTTATGTCCAGTTCGGTAAGAAGCGAATGAACTTCTCGCGGAAAGGATGA
 Primer design