SecReT4
Protein ID: 225872829
T4SS name [ID]Trb [794]
Gene symbol-
Locus tagACP_1188
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]1398972..1399826 [+]
Producthypothetical protein
Component typeTrbL
UniProt IDC1F4R7
KEGG IDaca:ACP_1188
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-19, Aligned region: 34..260
Protein Sequence: 284 a.a.     [Download]
>gi|225872829|ref|YP_002754286.1| hypothetical protein ACP_1188 [Acidobacterium capsulatum ATCC 51196]
MHLLILIKNGCDNLTATASPSVDAVGLHMVLALATIMLVWFGVQEALASAQGGAGFNVGRFLSFFLLITF
AYCFVKFYDSTIPGIGYSLKGFISGGTSSLVDYIGTDATQQIQNTIHAALNQAGTLSPSLTEPYTLLCTW
TVQIILSILTALIGVIIAYGAIGATVIGLVGPVFIPWMVFNKTEFLFWGWLKAFVGFEFYKVVAAATLSV
MSHLLIEYFTSGLHSFSEPQQLITLMPGLLILCFVAGFILLKIPTMTASLFSGNVGGHGFGAGGILTAAI
LRMF
 
Nucleotide Sequence: 855 bp     [Download]
>gi|225871699|ref|NC_012483.1|:1398972-1399826 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGCATCTCCTCATTCTCATTAAGAACGGTTGCGACAACCTTACTGCAACAGCTTCTCCATCTGTAGATG
CGGTTGGACTGCACATGGTGCTGGCGCTTGCCACCATCATGCTCGTCTGGTTCGGCGTTCAGGAGGCGCT
GGCCTCAGCGCAGGGCGGAGCCGGTTTTAATGTCGGGCGATTCCTGAGCTTTTTCCTGTTGATTACCTTC
GCTTACTGCTTCGTAAAGTTCTATGACAGCACAATTCCCGGCATCGGCTACTCCCTCAAGGGCTTCATCA
GCGGCGGCACCAGCAGCCTGGTCGATTACATTGGGACCGATGCGACACAGCAGATTCAAAATACCATCCA
CGCTGCTCTCAATCAGGCAGGCACCCTGTCTCCGTCGCTGACCGAGCCTTACACGCTTCTCTGCACATGG
ACGGTTCAGATCATCCTGTCCATTCTTACCGCGCTCATCGGCGTCATCATCGCCTATGGAGCAATTGGAG
CCACGGTCATTGGCTTGGTTGGCCCCGTGTTTATCCCTTGGATGGTATTCAACAAAACCGAATTCCTCTT
CTGGGGATGGCTGAAGGCGTTCGTAGGCTTCGAGTTCTACAAAGTCGTGGCCGCAGCTACGCTCAGCGTG
ATGAGTCATCTGCTCATCGAGTACTTTACGAGTGGCCTGCATAGCTTTTCCGAGCCGCAACAACTCATTA
CACTGATGCCCGGCCTGCTCATTCTGTGCTTTGTCGCCGGGTTCATTCTTCTCAAGATTCCCACCATGAC
CGCTTCGCTATTCTCAGGCAACGTCGGTGGGCATGGGTTCGGTGCAGGCGGAATTCTCACCGCCGCGATT
CTGCGGATGTTCTAA
 Primer design