SecReT4
Protein ID: 225874712
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3165
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3661888..3662241 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDC1F576
KEGG IDaca:ACP_3165
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.6e-07, Aligned region: 21..109
Protein Sequence: 117 a.a.     [Download]
>gi|225874712|ref|YP_002756171.1| hypothetical protein ACP_3165 [Acidobacterium capsulatum ATCC 51196]
MIRKLQSHKARKTEARRQVLRYLRASVPTLVAISLSSAAHAQGTMDFSGADTLMQTFKTFAVYAGAIICF
GGLIFAGIRMMTGRFQDAIPGLFGALFGAGVLGWGAGWIGSLTGQQM
 
Nucleotide Sequence: 354 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3661888-3662241 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGATTCGCAAGCTTCAATCCCACAAAGCCCGCAAAACTGAGGCGCGCCGGCAGGTACTCCGCTATCTGC
GTGCGTCGGTTCCAACCCTCGTTGCAATCTCTCTTTCCAGTGCTGCCCACGCCCAGGGAACGATGGACTT
CTCTGGTGCAGACACGCTGATGCAGACATTCAAAACGTTTGCTGTCTACGCTGGCGCGATCATCTGCTTT
GGCGGCCTGATCTTCGCCGGAATTCGCATGATGACCGGACGCTTTCAGGATGCCATTCCCGGTCTGTTCG
GTGCGCTGTTCGGCGCTGGGGTTCTCGGCTGGGGAGCTGGCTGGATTGGCTCGCTCACTGGGCAACAGAT
GTGA
 Primer design