SecReT4
Protein ID: 225874713
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3166
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3662254..3662517 [+]
Producttype IV conjugal DNA-protein transfer
Component typeTrbD
UniProt IDC1F577
KEGG IDaca:ACP_3166
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3e-12, Aligned region: 1..84
Protein Sequence: 87 a.a.     [Download]
>gi|225874713|ref|YP_002756172.1| type IV conjugal DNA-protein transfer [Acidobacterium capsulatum ATCC 51196]
MTRRGEQLPINQALNRPRAKLGLDLSAWMAIVFVCVTVFLVGFRLVAMIAFPTLAAGAWLIVRKHPKMFE
LWGLSLSQKSYYDPRKD
 
Nucleotide Sequence: 264 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3662254-3662517 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGACCCGACGAGGAGAACAGTTACCGATCAATCAGGCGCTTAATAGGCCACGGGCCAAGCTCGGATTGG
ACCTCAGCGCATGGATGGCGATCGTATTCGTCTGCGTAACGGTTTTCCTCGTTGGATTTCGTCTGGTGGC
GATGATCGCCTTCCCCACGCTTGCAGCGGGGGCCTGGCTCATCGTTCGCAAACACCCGAAGATGTTCGAA
CTCTGGGGTCTGAGCCTCAGCCAGAAGTCCTACTATGACCCGCGCAAAGACTGA
 Primer design