SecReT4
Protein ID: 225874714
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3167
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3662498..3664867 [+]
Producttype IV secretion/conjugal transfer ATPase
Component typeTrbE
UniProt IDC1F578
KEGG IDaca:ACP_3167
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.6e-32, Aligned region: 446..719
CagE_TrbE_VirB [PF03135], Evalue: 7.5e-13, Aligned region: 229..282
CagE_TrbE_VirB [PF03135], Evalue: 7.5e-13, Aligned region: 293..390
Protein Sequence: 789 a.a.     [Download]
>gi|225874714|ref|YP_002756173.1| type IV secretion/conjugal transfer ATPase [Acidobacterium capsulatum ATCC 51196]
MTRAKTEQAKFVPWFAKAGAACSIVPIARFVNEHIFALKGGGYGCLFSLAGIDEEGLTDPELEARMRSLE
GALHGLPEGSCLYQYTRLMSGFELPRRPHYQNPVTQVFADDRLTFLERTAGFRRIDLHWCLTIEPPRIKA
FQQKPKELAADTSRMLAELEKTATILEGHLGSSLGLRLLGKDAAFQFFSYVFNLEEWAEDDQLRANTGVD
RQIVKNPITWHSDHLRVGKRYVQMFSLKATPEASRPCLFSSLLTLDCDSIVCSTWRPKSTAAARSEIDAQ
EKFISFFKVGVLTRVMSGRDTASLETGAGAKAANSSVDDLSEVIRSLDKKSQGEYSLRLLLAANSPEHLR
DTIPAVHRAFVDARTQMIEESLGNLSAFYAMFPGNGKFNVFPLWLSEDHHARLSSIFAPHLGHPHSEDLD
AEYLNVFETRTRTPFFQDVYVDGVRVMLILGPTGTGKSVHGNQLIALEQKYGGFSYIFDIGGSYESVVEL
YGGRVDRIGKDGPRVNPFALEPTESNLKFLYTFIRLLLANGGAELEPEDDDVIHKAVQDMYLLDRENRRL
SNLYLPKKLDRYLSKWVRDGVYHAIFDNVEDGLSLSRVQCFDFAGVNNEQYADLIEPLMVWLLRRINDVL
HDPANLGVPKHILIEELFPSMKNRQLLEGALSSIKTVRKNLGGVTLIGQSAEDLGENADSIVNSCSSFLL
LKDPTFNRKRYAELFRMNEQQLALFESLQDREALYIRRDGLTKVVILNLDSRSYATFSTKPKDRVRRSKL
IAKYGLAEGIDRFAQGEIA
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3662498-3664867 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGACCCGCGCAAAGACTGAACAAGCAAAATTCGTGCCATGGTTCGCGAAGGCCGGAGCCGCGTGCAGCA
TCGTTCCGATTGCACGCTTCGTCAATGAGCACATCTTTGCGCTCAAAGGCGGCGGGTACGGATGCCTGTT
CTCTTTAGCCGGTATCGATGAAGAGGGGCTGACTGACCCGGAACTCGAAGCGCGGATGCGTTCGCTGGAG
GGAGCGCTCCATGGCCTGCCAGAGGGTTCATGCCTCTATCAGTACACCCGCTTGATGTCCGGCTTCGAGC
TGCCGCGCCGACCGCATTACCAAAATCCTGTGACGCAAGTATTCGCGGATGACCGACTGACGTTTCTTGA
GAGAACCGCGGGATTCCGACGCATCGACCTGCACTGGTGCCTGACCATCGAGCCGCCAAGGATCAAGGCA
TTCCAGCAGAAGCCGAAAGAGCTCGCCGCCGACACTTCGCGGATGCTCGCCGAACTTGAGAAGACGGCCA
CGATTCTGGAAGGTCATCTTGGCAGTTCGTTGGGACTGCGGCTGCTCGGCAAGGATGCCGCATTCCAATT
CTTCAGTTACGTTTTCAACCTGGAGGAATGGGCGGAGGATGACCAACTCCGGGCCAATACCGGTGTAGAC
CGCCAGATTGTGAAAAACCCGATTACCTGGCATAGCGACCATCTGCGGGTGGGCAAGCGCTACGTTCAGA
TGTTTTCCCTGAAGGCGACGCCGGAGGCATCCAGGCCATGCCTCTTTTCCAGCCTACTGACGCTCGACTG
CGACAGCATCGTCTGCTCAACATGGCGGCCAAAGTCCACCGCAGCGGCTCGAAGCGAGATCGACGCCCAG
GAGAAGTTCATTTCCTTCTTCAAGGTTGGCGTGCTGACGCGCGTCATGAGCGGGCGTGATACGGCATCGC
TCGAAACCGGAGCCGGGGCAAAGGCCGCCAATAGCAGTGTCGATGATCTGAGCGAAGTCATCCGCTCGCT
CGATAAAAAGTCCCAGGGCGAATACTCGCTCCGCCTCTTGCTGGCTGCAAACAGCCCGGAGCACTTGCGC
GATACCATCCCCGCCGTACATCGAGCATTCGTCGATGCACGGACACAGATGATCGAGGAATCGCTCGGCA
ATCTCTCCGCGTTCTATGCCATGTTCCCCGGCAATGGAAAGTTCAACGTCTTCCCACTGTGGCTGTCGGA
AGATCATCATGCCCGGCTTTCCTCGATATTTGCTCCGCATCTCGGCCATCCGCACTCCGAGGATCTCGAT
GCCGAGTATCTGAATGTCTTCGAGACACGCACGCGAACGCCGTTCTTTCAGGACGTGTACGTCGATGGCG
TGCGGGTGATGCTCATCCTTGGGCCGACCGGCACGGGCAAATCCGTCCATGGGAATCAGCTCATTGCCTT
GGAACAGAAATACGGTGGCTTCAGCTACATCTTCGACATCGGTGGCAGCTATGAGAGTGTCGTCGAATTG
TACGGCGGACGGGTTGACCGCATTGGCAAGGATGGCCCCCGTGTCAATCCCTTCGCGCTGGAGCCGACCG
AGAGCAACCTCAAGTTCCTGTACACCTTCATTCGCCTGCTGCTGGCCAACGGCGGAGCCGAACTGGAACC
CGAAGACGACGACGTGATTCACAAGGCGGTGCAGGATATGTACCTGCTCGACCGGGAGAACCGCCGCCTC
TCGAACCTCTACCTGCCGAAGAAGCTCGATCGTTACCTCTCGAAATGGGTCCGGGATGGCGTCTACCACG
CGATCTTCGACAACGTGGAGGACGGGTTGTCTCTCTCGCGCGTGCAGTGCTTCGACTTCGCGGGTGTCAA
CAACGAGCAGTATGCCGACTTGATCGAACCGCTAATGGTCTGGCTTCTGCGTCGCATCAACGATGTGCTC
CACGATCCGGCGAATCTCGGAGTCCCCAAGCACATTCTCATCGAGGAACTCTTCCCTTCGATGAAGAATC
GCCAGTTGCTCGAAGGCGCGCTCTCCTCCATCAAGACGGTGCGCAAGAATCTCGGCGGTGTGACACTGAT
CGGCCAGTCCGCAGAAGACCTCGGCGAGAACGCGGACAGCATCGTGAATTCCTGCTCGTCTTTTCTGTTA
TTGAAAGACCCAACCTTCAATCGCAAGCGTTACGCCGAACTCTTCCGGATGAATGAGCAACAACTGGCGC
TCTTCGAGAGCCTGCAGGACCGCGAAGCTCTGTACATCCGCCGCGACGGGCTCACAAAGGTTGTCATCTT
GAATCTCGACAGCCGCAGCTATGCCACCTTCTCCACCAAGCCCAAGGACCGGGTACGCCGGTCGAAGTTG
ATCGCCAAATACGGACTCGCCGAGGGTATCGACCGCTTTGCCCAAGGTGAAATCGCCTAA
 Primer design