SecReT4
Protein ID: 225874715
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3168
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3665110..3665721 [+]
Producthypothetical protein
Component typeTrbG
UniProt IDC1F579
KEGG IDaca:ACP_3168
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.9e-16, Aligned region: 11..198
Protein Sequence: 203 a.a.     [Download]
>gi|225874715|ref|YP_002756174.1| hypothetical protein ACP_3168 [Acidobacterium capsulatum ATCC 51196]
MDWVFDGGHVASRFISIKPKAAGSTTDVHIISDHGNEYTLELQEVSGQADPHFDSKVFLVPGDKSAKEKL
TELPVFVPASELNQAKQEVAAAKAAEARTLKAEQTKEEEYRSRYPGTLRFDYTWNKSKGDALGLHEIWHD
HKFTYLRGQFQETPALYEVKDGKPSLINFDFSNGLYIVPKELDRGYLTIGKRKVEFHRTDGGN
 
Nucleotide Sequence: 612 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3665110-3665721 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
GTGGATTGGGTGTTTGACGGAGGCCATGTTGCGAGCCGATTTATCAGCATTAAGCCGAAGGCCGCCGGCA
GCACCACGGATGTCCACATCATCTCCGACCACGGCAATGAGTACACGCTGGAACTTCAGGAGGTTTCAGG
CCAAGCTGATCCGCACTTCGATTCCAAAGTGTTCCTCGTACCCGGTGACAAATCAGCAAAAGAGAAGTTG
ACCGAGCTGCCGGTCTTTGTGCCTGCGTCGGAGCTGAACCAGGCCAAGCAGGAGGTTGCAGCGGCAAAAG
CAGCGGAGGCGAGAACGCTCAAGGCAGAACAAACGAAAGAGGAAGAGTACCGGAGCCGCTATCCCGGCAC
GCTCCGCTTTGACTACACCTGGAACAAGTCGAAAGGCGACGCGCTTGGGCTTCACGAGATCTGGCACGAC
CACAAATTCACCTACTTACGCGGCCAGTTTCAGGAGACGCCTGCCCTCTACGAAGTGAAAGATGGCAAGC
CGTCTCTGATCAACTTCGACTTCTCGAATGGCCTGTACATCGTGCCCAAGGAACTCGACCGCGGCTACCT
CACCATCGGCAAGCGGAAGGTGGAGTTCCATCGCACGGACGGAGGCAACTAG
 Primer design