SecReT4
Protein ID: 225874716
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3169
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3665724..3666980 [+]
Productconjugal transfer protein, TrbI family
Component typeTrbI
UniProt IDC1F580
KEGG IDaca:ACP_3169
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.1e-31, Aligned region: 229..404
Protein Sequence: 418 a.a.     [Download]
>gi|225874716|ref|YP_002756175.1| conjugal transfer protein, TrbI family [Acidobacterium capsulatum ATCC 51196]
MPELNQNTPATVPEQPEAKPPVRKTMPVVIALVVIMALIGIANLSSLLRGSKRSTSATAMPIRPAAPNAQ
EVNSFETQQHLQAERDAQERQHQQEITAAMQQLEAAEGIPGPEGTTTPPMTAAQRAAIYGQSPNAPVITS
SVSEERAEAKQRELAKEKQHRDALASDTVAIDFESSGSTPASSHATRSPEAQPDMPATTPTVAPRAKSPN
ASNAMTPYPFDHYQGKLYRIFEGTILEGVVTNHIDGGFSGPVLVMLTTDYYSHDHQHLLMPQGTRLIGTV
QSIGNAQQRKMFVTFHRAICPDGFSIDFDKYIGLDQIGTTGLATKIHHGYFQAFAAAAMIGGLGGLAQIG
NNGSILDPSTEIRNGISQQSAAEGEQVLNHFLDRLPVITLKEGSRARVYVGRDILVPSYSEHRMDPNL
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3665724-3666980 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGCCGGAACTCAATCAGAACACGCCCGCGACGGTTCCCGAACAGCCCGAAGCCAAACCGCCTGTCCGGA
AGACCATGCCCGTGGTTATCGCGCTGGTTGTCATTATGGCGCTCATCGGGATTGCCAATCTCTCCAGCCT
GCTCAGGGGAAGCAAACGGTCAACATCTGCAACCGCCATGCCGATACGACCGGCAGCTCCGAATGCGCAA
GAAGTAAACAGCTTCGAGACGCAACAGCATTTGCAGGCCGAACGCGACGCCCAGGAGCGACAGCACCAGC
AGGAGATCACGGCAGCCATGCAGCAACTTGAAGCTGCGGAAGGTATTCCCGGCCCCGAAGGAACGACCAC
TCCCCCCATGACCGCCGCGCAACGGGCCGCGATCTATGGCCAAAGTCCCAATGCTCCGGTCATCACGTCG
AGTGTTTCCGAAGAGCGTGCGGAGGCGAAGCAGCGCGAACTGGCCAAAGAAAAGCAACACAGGGATGCTC
TGGCCAGTGACACGGTCGCCATCGACTTTGAGTCTTCTGGTTCCACCCCAGCCAGTTCGCACGCGACTCG
GTCACCGGAGGCGCAACCGGACATGCCCGCGACAACGCCAACCGTCGCTCCGAGAGCAAAGTCTCCAAAT
GCCTCCAATGCGATGACTCCATATCCTTTCGACCACTACCAAGGCAAGCTTTATCGAATCTTTGAGGGCA
CGATCCTTGAGGGCGTCGTGACCAACCATATCGACGGCGGTTTCAGTGGACCCGTCCTGGTCATGCTCAC
CACGGACTACTATTCGCACGACCATCAGCATCTTCTGATGCCACAAGGGACGCGACTGATTGGAACAGTA
CAGAGCATCGGCAATGCTCAGCAGCGCAAGATGTTTGTTACGTTCCACCGTGCTATTTGCCCAGACGGCT
TTTCCATCGACTTCGATAAATACATCGGTCTAGACCAGATCGGCACCACCGGGCTCGCTACAAAGATCCA
CCACGGATACTTTCAGGCGTTTGCCGCCGCAGCCATGATCGGCGGCCTTGGAGGGCTGGCCCAAATTGGC
AACAACGGCAGCATCCTTGATCCCTCGACCGAGATCCGCAACGGCATCTCCCAGCAGTCAGCCGCTGAAG
GCGAACAGGTGCTGAACCACTTTCTTGACCGCCTGCCAGTCATCACCCTCAAGGAAGGCTCGCGCGCCCG
CGTCTACGTGGGCCGCGACATCCTCGTACCGTCCTACTCAGAACACCGAATGGACCCCAACCTTTAA
 Primer design