SecReT4
Protein ID: 225874717
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3170
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3666999..3667772 [+]
Producthypothetical protein
Component typeTrbJ
UniProt IDC1F581
KEGG IDaca:ACP_3170
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|225874717|ref|YP_002756176.1| hypothetical protein ACP_3170 [Acidobacterium capsulatum ATCC 51196]
MKNRKKWIIGAAALLLTATPSFALFGLGDIVFDPTSYGNLVSQLTTMETQYRMLKNNIEHFSFKQQWETA
FSAMKQANVRDLFGETNGMTTALNTNSPAASSTAWTAATVPVNGTTTTYLAGETPGSAQLSELAMIEASD
SVSPDCLTAIGQYRAARAQNTAANNSLASEQLDGSTATNSEVEQLNLLNAAQAQKMSEMQSQGVLQACLA
SEMAVGNMQQRNAAALDLNTAAYVAQQRAADDTSAANESNTWDSYLP
 
Nucleotide Sequence: 774 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3666999-3667772 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGAAAAACCGAAAGAAATGGATCATTGGCGCGGCGGCACTGCTGCTCACAGCCACCCCGAGCTTTGCAC
TCTTCGGTCTCGGCGACATCGTCTTTGACCCGACGAGCTACGGGAACCTTGTCTCGCAGCTCACCACGAT
GGAAACGCAGTACAGGATGCTCAAGAACAACATCGAGCACTTCTCCTTTAAGCAGCAGTGGGAGACCGCC
TTCAGCGCCATGAAGCAGGCCAATGTCCGCGACCTGTTCGGCGAGACGAACGGTATGACGACTGCCTTGA
ACACAAACTCGCCGGCAGCCTCGTCCACGGCGTGGACGGCGGCCACCGTTCCCGTCAACGGCACGACGAC
CACCTATCTTGCTGGCGAGACACCGGGGAGTGCGCAGCTCTCCGAACTTGCCATGATCGAAGCATCCGAT
TCCGTCTCGCCCGACTGCCTGACCGCCATCGGCCAGTACCGGGCCGCGCGAGCCCAGAACACGGCGGCCA
ACAACAGTCTTGCCTCAGAGCAGCTTGACGGCAGCACAGCGACCAACAGCGAAGTGGAACAGCTCAATCT
GCTGAACGCCGCTCAGGCCCAGAAGATGTCCGAGATGCAGTCCCAGGGGGTCCTGCAAGCCTGCCTCGCA
TCGGAGATGGCCGTTGGCAACATGCAGCAGCGCAACGCCGCGGCGCTTGACCTCAACACCGCCGCCTACG
TCGCCCAGCAGCGCGCGGCGGACGATACCAGCGCCGCAAATGAAAGCAACACCTGGGACAGCTACCTTCC
CTAG
 Primer design