SecReT4
Protein ID: 225874719
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3172
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3668021..3668941 [+]
Producthypothetical protein
Component typeTrbL
UniProt IDC1F5J3
KEGG IDaca:ACP_3172
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-05, Aligned region: 122..278
Protein Sequence: 306 a.a.     [Download]
>gi|225874719|ref|YP_002756178.1| hypothetical protein ACP_3172 [Acidobacterium capsulatum ATCC 51196]
MVPTTLLAQALPTTSSGVDWLYQFTNNLTNLTTQNGGALTQFGLTELSAIALFTLISMVINWNTSGMTLR
FHTHPVRAGDLTNFMLRLILCSLLLNYWVNPLPGASFGINHFFSYIAQAMVAVFDQNSLNHLLVLLKTAG
DNTPMPSIMAPVEILCYFVVQGLLGIASAILFVINCSAFILYGVTALFGPVFIPLLMTRTFRAKFFHFLD
VLVSFAMIRAVAAAFIFVWAGFMNTFLQQTFSGNYSIAMWLANLIPCIMVFIAFIVNMLFIPSMTQAIFG
GAAGLTSAAAGAAGSAAGLFLMKSGA
 
Nucleotide Sequence: 921 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3668021-3668941 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGGTTCCGACGACACTGCTGGCACAGGCGCTACCGACCACGAGTTCCGGCGTGGACTGGCTGTACCAGT
TCACTAACAATCTGACCAACCTCACCACGCAGAATGGCGGTGCGCTCACACAGTTCGGTTTGACCGAGTT
GAGCGCCATCGCCCTTTTCACGCTCATCAGCATGGTCATCAACTGGAACACTTCGGGCATGACCCTGCGT
TTTCATACGCATCCAGTCCGGGCCGGCGATCTGACGAACTTTATGCTCCGGCTGATACTTTGCTCTCTTC
TGCTGAATTACTGGGTCAACCCGCTTCCGGGCGCAAGCTTTGGCATCAATCACTTCTTCAGCTACATCGC
GCAGGCGATGGTGGCCGTCTTCGATCAGAATTCGCTCAATCATCTGCTCGTGTTGCTGAAAACGGCAGGC
GACAACACCCCCATGCCCTCGATTATGGCGCCTGTTGAGATCCTCTGCTATTTCGTGGTGCAGGGATTGC
TTGGCATAGCTTCTGCCATTCTGTTCGTCATCAATTGCAGCGCCTTTATCCTCTACGGCGTGACGGCGCT
CTTCGGGCCGGTATTCATTCCACTGCTCATGACTCGAACCTTCCGCGCCAAGTTCTTTCACTTCCTGGAC
GTGCTGGTCAGCTTCGCGATGATTCGCGCCGTGGCCGCCGCTTTCATCTTCGTGTGGGCCGGATTCATGA
ACACATTTCTTCAGCAGACCTTCAGCGGAAATTATTCCATTGCGATGTGGCTTGCGAACCTCATTCCCTG
CATCATGGTGTTCATCGCCTTCATCGTGAACATGCTGTTCATTCCCAGCATGACGCAGGCGATTTTCGGC
GGGGCTGCTGGGTTGACATCTGCTGCAGCAGGAGCAGCGGGCAGCGCAGCCGGATTGTTCTTAATGAAGT
CGGGAGCGTAA
 Primer design