SecReT4
Protein ID: 225874720
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3173
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3669116..3669901 [+]
Producthypothetical protein
Component typeTrbF
UniProt IDC1F5J4
KEGG IDaca:ACP_3173
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-09, Aligned region: 25..240
Protein Sequence: 261 a.a.     [Download]
>gi|225874720|ref|YP_002756179.1| hypothetical protein ACP_3173 [Acidobacterium capsulatum ATCC 51196]
MSTHTALVEQSLTPAQALLTDQVGNEVYASHYAERKAYRLILGCGTVLLCSSMWLNFSLATRPVVDRYIR
INAMGRAQAIQYSDLDFTPRDGEVRTYLTDWANYRYTIHPDTIATKYPLNYYFLSQSLASRLMSEDNRNH
LVSKVMSGQIEQSDVVVRDVTITSMSVEKVQGEKMARGTALVALDRIYSPAHSQHPRTEHWMVSVTYYLN
PAQVSRQAQVFPQFETINPLGLTITQFHQNEVSVDPLVPGANAAPAGGTTR
 
Nucleotide Sequence: 786 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3669116-3669901 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGTCCACGCACACAGCACTCGTTGAACAATCCCTGACTCCAGCGCAAGCGCTTCTGACCGACCAGGTCG
GCAACGAGGTCTACGCCTCGCATTACGCGGAACGGAAAGCCTATCGCCTCATCCTCGGCTGCGGAACAGT
GCTGCTGTGCAGTTCCATGTGGCTCAACTTCTCGCTTGCCACCCGCCCGGTCGTCGATCGCTACATCCGC
ATCAATGCGATGGGACGTGCCCAGGCCATCCAGTATAGTGACCTCGACTTCACGCCGCGCGATGGGGAGG
TGCGGACGTATCTCACCGACTGGGCCAACTACCGCTATACGATCCACCCTGACACCATCGCGACGAAGTA
TCCCCTGAACTATTACTTTCTGTCGCAATCGTTGGCCTCGCGGCTCATGTCCGAAGACAACCGGAACCAC
CTTGTCTCGAAGGTCATGTCCGGGCAGATTGAGCAGAGCGATGTCGTGGTTCGGGATGTGACTATTACGT
CCATGTCCGTCGAGAAGGTGCAGGGCGAGAAGATGGCGCGTGGGACTGCGCTGGTGGCCCTCGACCGAAT
CTATTCTCCAGCCCACTCCCAACATCCTCGCACCGAGCACTGGATGGTCAGCGTGACCTACTATCTGAAC
CCGGCCCAGGTCAGCCGGCAGGCTCAGGTATTCCCGCAGTTCGAGACCATCAATCCGCTGGGCCTTACGA
TCACGCAGTTCCACCAGAACGAAGTATCCGTTGATCCATTGGTGCCGGGCGCAAACGCCGCGCCGGCAGG
AGGGACCACGCGATGA
 Primer design