SecReT4
Protein ID: 225874723
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3176
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3670809..3671777 [+]
Producttype II/IV secretion system protein
Component typeTrbB
UniProt IDC1F5J7
KEGG IDaca:ACP_3176
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-66, Aligned region: 14..288
Protein Sequence: 322 a.a.     [Download]
>gi|225874723|ref|YP_002756182.1| type II/IV secretion system protein [Acidobacterium capsulatum ATCC 51196]
MSYELILPFFPEELRALLLDPSISDLMINGTSGVYADRGGRIEEIALTAPYTNDRLQAAIERVARVLGQD
LTSQNPILNTRLPDGSRVAVVGPPSSIHGTTLTIRKFNRWYSSDELVASETMTQEVRDAVVGLIHERKNG
IISGGTGSGKTTLMKALLDHVPVEERLIVIEQPAELKIAHPNAVRWEAVDAIPGQVAVTTSQLVAAALRH
RPDRIIMGEIRDECGYDLLQAMNTGHGGTLSTLHADSALDALDRLADMALSARINLNQAFVRSQTGKAVD
FVLHCERDAGGRRRVRELITVSGYSHQDGCFQTEEVYRASCT
 
Nucleotide Sequence: 969 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3670809-3671777 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGAGTTACGAGCTGATTCTCCCGTTCTTTCCCGAGGAATTGCGCGCGCTGCTGCTTGATCCTTCGATCT
CGGATCTCATGATCAACGGCACCAGCGGCGTCTATGCCGACCGTGGCGGCAGAATCGAGGAGATTGCTCT
GACGGCGCCCTACACAAACGACCGCCTGCAAGCTGCCATTGAGCGGGTCGCCAGGGTTCTCGGGCAGGAC
CTCACCAGCCAGAATCCCATCCTCAATACCCGCCTGCCGGACGGCTCCCGCGTGGCGGTCGTTGGGCCAC
CGTCGTCCATTCATGGGACGACGCTGACCATCCGCAAATTCAACCGCTGGTATTCCTCCGACGAACTAGT
GGCATCGGAAACGATGACGCAGGAGGTTCGAGATGCGGTCGTCGGGCTCATCCACGAGCGCAAGAACGGC
ATTATCAGTGGTGGTACAGGTTCGGGCAAGACGACCCTGATGAAGGCCCTGCTCGATCATGTTCCAGTCG
AGGAACGGCTGATCGTCATCGAGCAGCCTGCAGAGTTGAAGATTGCTCACCCGAATGCCGTGCGCTGGGA
GGCCGTCGATGCCATCCCTGGCCAGGTGGCCGTCACGACCAGCCAGCTCGTAGCTGCTGCTCTGCGCCAC
CGACCTGACCGCATCATCATGGGCGAGATACGCGACGAGTGCGGCTACGACCTGTTGCAGGCCATGAACA
CAGGCCACGGGGGGACGCTCTCGACCCTGCATGCCGACTCCGCGCTCGACGCTCTGGACCGGCTGGCCGA
CATGGCGCTGAGTGCCCGCATCAATCTCAATCAGGCGTTTGTGCGTTCGCAGACCGGCAAGGCTGTCGAT
TTCGTGCTGCATTGCGAACGCGATGCCGGGGGCCGCCGCCGGGTACGAGAGCTGATTACCGTTTCCGGCT
ACAGCCATCAGGACGGCTGCTTCCAGACGGAGGAGGTCTATCGTGCTTCCTGTACCTGA
 Primer design