SecReT4
Protein ID: 225874727
T4SS name [ID]Trb [795]
Gene symbol-
Locus tagACP_3181
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3674604..3676604 [+]
Producthypothetical protein
Component typeTraG
UniProt IDC1F5K1
KEGG IDaca:ACP_3181
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.4e-86, Aligned region: 219..579
TraG-D_C [PF12696], Evalue: 4.4e-15, Aligned region: 451..569
T4SS-DNA_transf [PF02534], Evalue: 6.3e-12, Aligned region: 414..573
AAA_10 [PF12846], Evalue: 9.2e-05, Aligned region: 228..288
Protein Sequence: 666 a.a.     [Download]
>gi|225874727|ref|YP_002756186.1| hypothetical protein ACP_3181 [Acidobacterium capsulatum ATCC 51196]
MAKMTWGRKETIIWPQNRPIYTYAAIFLALTLTAVFVFGWVRFFTRPLQWFYAPVYVRTSILGTFSRTHR
SEYRMLFLTGHGSKPGPVMNGDVVHGRTPEPGGRVLPLALSVTALQRGNDLLFRGPVRSYVDARLHEYLK
AAVYEGRDVSAILKPPMLCGAGLFLILLPFAVTLDVKRQKALKYGRRLKGPERLTPQAFNRAVKGDGIGF
KTDDMKEMIRIPAKAEAQHMQIIGDTGAGKSAMLFQVLRQVRGREDSAIVYDPAREFVKRFYDPSRGDVI
LNPFDKRCPYWGLAEELRSRSEAKALAASLFQPPQDRKGEFFIESPQKIFAFLMAYGPTPDELVQWMSNP
DEIDRRLKGTEHAHLIDPRAHQQRAGVLGSLALVADSLRLLPKKGEGNGRWTATEWAEKRQGWIFITSLP
AEREALRPLQSLWIDWLVLRLLNEPTKEQKRVWFVIDELASLQKLPQLHTAITESRKSRNPVVLGFQGKA
QLEYLYGHLAEVMLSQPATSVWLTTKEPNAGEWVSKFIGKVEIERLRETHFDGTRSGHNFTIERQVEPLV
LESEISGLPDLHAFMKYQNYVTYFSFPYFDMPEVAKPFELRERTDDKLPYDPTALREGRPQAELKQEPEA
PVPAPEPNEPVASEAIQPELSAAPADQEEQNVITHG
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|225871699|ref|NC_012483.1|:3674604-3676604 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGGCAAAGATGACATGGGGGCGTAAAGAGACCATTATCTGGCCGCAGAACCGGCCCATCTATACCTACG
CAGCGATCTTCTTGGCGCTGACTCTTACGGCAGTGTTTGTGTTCGGATGGGTTCGCTTTTTCACCAGACC
GTTGCAGTGGTTCTACGCTCCCGTTTATGTCCGCACGTCTATCCTCGGCACCTTCAGTCGGACACACAGA
AGCGAGTACCGGATGCTGTTTCTTACCGGCCACGGATCGAAGCCAGGGCCGGTAATGAATGGGGATGTTG
TGCATGGACGGACGCCGGAACCCGGTGGCCGTGTTCTCCCTCTCGCGCTCTCTGTCACGGCACTTCAACG
CGGGAACGACCTCCTCTTTCGCGGCCCGGTACGGAGCTATGTGGATGCCCGGCTTCATGAGTACCTGAAG
GCGGCTGTCTATGAGGGACGCGACGTGTCCGCCATCCTTAAACCGCCCATGCTTTGCGGTGCGGGACTGT
TTCTCATATTGCTTCCGTTCGCCGTCACGCTGGACGTGAAGCGGCAAAAAGCGTTGAAGTACGGACGCCG
CCTGAAAGGCCCGGAACGACTCACGCCGCAAGCGTTCAATCGCGCAGTCAAAGGGGATGGCATCGGATTC
AAAACCGACGACATGAAGGAGATGATTCGGATTCCCGCGAAGGCCGAAGCACAGCACATGCAGATCATCG
GTGACACAGGCGCAGGCAAGTCCGCGATGCTTTTTCAGGTGCTCCGGCAGGTACGGGGCCGGGAGGATTC
GGCCATTGTGTACGACCCTGCCCGCGAATTCGTTAAGCGGTTCTATGACCCGTCGCGTGGCGATGTCATC
CTGAATCCCTTCGATAAGCGTTGCCCGTATTGGGGACTAGCCGAGGAGCTGCGTAGTCGCTCCGAAGCGA
AGGCCCTGGCCGCCTCTCTCTTTCAGCCGCCGCAGGACCGGAAGGGTGAGTTTTTCATCGAGTCGCCGCA
GAAGATCTTTGCTTTCCTGATGGCCTATGGGCCGACGCCGGACGAGCTGGTGCAGTGGATGTCCAATCCC
GATGAGATCGACCGCAGACTCAAAGGAACGGAGCACGCGCATCTGATTGATCCGCGAGCGCACCAGCAGC
GGGCCGGTGTTCTCGGCTCCCTCGCATTGGTTGCGGACAGCTTGCGTCTCTTGCCGAAAAAGGGTGAAGG
CAACGGCAGATGGACGGCTACCGAATGGGCCGAGAAACGCCAGGGATGGATCTTCATTACCTCTCTTCCC
GCCGAACGCGAGGCGTTGCGTCCGCTGCAAAGTCTCTGGATTGACTGGCTGGTTTTGCGGCTCCTGAATG
AGCCGACCAAAGAGCAAAAGCGGGTGTGGTTTGTTATCGACGAGCTGGCGAGTTTGCAGAAGTTGCCACA
GCTTCATACGGCCATCACCGAGAGCCGTAAGAGCCGGAATCCGGTGGTGCTTGGCTTTCAGGGAAAGGCC
CAACTGGAATACCTGTACGGCCATCTGGCCGAGGTGATGCTATCGCAGCCAGCGACGAGTGTTTGGCTCA
CGACAAAGGAGCCGAATGCCGGGGAGTGGGTGAGCAAGTTCATCGGCAAGGTAGAGATTGAACGCCTGCG
CGAGACGCACTTCGACGGCACTAGATCAGGCCACAACTTCACCATTGAGAGGCAGGTGGAGCCGCTGGTA
TTGGAGTCGGAAATCTCAGGCCTGCCCGACCTGCACGCCTTCATGAAGTACCAGAACTATGTAACGTACT
TCTCGTTTCCTTACTTCGATATGCCCGAAGTTGCCAAGCCCTTCGAGCTGCGCGAGCGCACCGACGACAA
GCTGCCATACGACCCCACAGCTTTGCGCGAAGGCCGACCGCAGGCGGAATTGAAACAGGAGCCGGAGGCC
CCGGTTCCTGCACCTGAGCCGAATGAGCCTGTTGCTTCGGAGGCGATCCAGCCGGAGCTTTCTGCCGCCC
CTGCCGATCAAGAAGAACAGAACGTGATTACGCACGGTTGA
 Primer design