SecReT4
Protein ID: 225874797
T4SS name [ID]Trb [796]
Gene symbol-
Locus tagACP_3255
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3777012..3777926 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDC1F5S1
KEGG IDaca:ACP_3255
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.8e-05, Aligned region: 130..278
Protein Sequence: 304 a.a.     [Download]
>gi|225874797|ref|YP_002756256.1| hypothetical protein ACP_3255 [Acidobacterium capsulatum ATCC 51196]
MVSADLLAQTLPTASSGVDWLYQFTNNLTNLTTQNGGALTQFGLTELSCIALFTLISMVINWNTSGMTLR
FHTHPVRAGDLTNFLLRLILCCLLENYWVNPFPGASFGINHFFSYIAQAMVAVFDQNSLNHLLMLLKTAG
DNTPMPSIMAPVEILCYFVVQGLLGIASAILFVINCSAFILYGVTALFGPVFIPLLMTQTFRAKFFHFLD
VLVSFAMIRAVAAAFIFVWAGFMNTFLQQTFNGNYSIAMWLANLIPCIMVFIAFIVNMLFIPSMTQAIFG
GAAGLTSAAPGVVGSLAALKSGGA
 
Nucleotide Sequence: 915 bp     [Download]
>gi|225871699|ref|NC_012483.1|:c3777926-3777012 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGGTTTCCGCAGATTTATTGGCTCAGACATTACCGACCGCAAGTTCCGGCGTGGACTGGCTCTACCAGT
TCACCAACAATTTGACCAACCTCACCACGCAGAATGGCGGGGCGCTGACGCAGTTCGGCCTGACGGAACT
CAGTTGCATTGCACTCTTCACTCTCATCAGCATGGTCATCAACTGGAACACCTCGGGGATGACGTTGCGC
TTTCATACCCATCCGGTACGGGCGGGCGATCTTACCAACTTCCTGTTGCGTCTCATTCTTTGCTGCCTGC
TCGAAAACTACTGGGTCAACCCGTTTCCGGGCGCGAGCTTCGGCATCAATCACTTCTTCAGCTACATCGC
GCAGGCGATGGTCGCCGTCTTCGATCAGAACTCACTCAATCATCTGCTCATGTTGCTGAAGACGGCAGGC
GACAACACCCCCATGCCGTCGATCATGGCTCCCGTTGAGATCCTCTGCTATTTCGTGGTGCAGGGATTGC
TTGGCATTGCGTCTGCGATTCTCTTTGTCATCAATTGCAGCGCCTTCATCCTCTACGGCGTGACGGCGCT
CTTCGGGCCTGTATTCATTCCACTGCTCATGACTCAGACCTTCCGTGCCAAGTTCTTTCACTTCCTCGAC
GTGCTGGTCAGCTTCGCGATGATCCGCGCCGTGGCCGCCGCTTTCATCTTCGTGTGGGCCGGATTCATGA
ACACATTTCTTCAGCAGACCTTCAACGGAAATTATTCGATTGCGATGTGGCTTGCCAACCTCATTCCCTG
CATCATGGTGTTCATCGCCTTCATCGTGAACATGCTGTTCATTCCCAGCATGACGCAGGCGATTTTCGGC
GGGGCTGCTGGACTGACTTCAGCCGCTCCAGGTGTTGTAGGAAGTTTGGCTGCTTTGAAAAGTGGAGGTG
CTTAA
 Primer design