SecReT4
Protein ID: 225874802
T4SS name [ID]Trb [796]
Gene symbol-
Locus tagACP_3260
StrainAcidobacterium capsulatum ATCC 51196
Repliconchromosome [GenBank: NC_012483] [Browse all T4SS(s) in this replicon]
Location [Strand]3780255..3781088 [-]
Productconjugal transfer protein
Component typeTrbG
UniProt IDC1F5S6
KEGG IDaca:ACP_3260
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-22, Aligned region: 47..272
Protein Sequence: 277 a.a.     [Download]
>gi|225874802|ref|YP_002756261.1| conjugal transfer protein [Acidobacterium capsulatum ATCC 51196]
MKPLIPVAVILSLTFACASSRAATHPPQPQPNPPRTVIVTATAAPPVIDTALLQSTLLILPPQEKVANVF
AGDTVDWVIDGGHVASRFLSVKPKTAGAETDIHIISDHGNEYTLELREVSGETDPHFDSKVFLEPGDKAA
KARLIELPIFVPAAELKAEKEELKSAEATEAAAIRKERAKAEEFRSQYPGTLRFDFTWNKSKGNALGLHE
IWHDSKFTYLRGDFEETPALYEVKAGKPSLINYDFNDGLYTVPKELARGYLIIGKQKVEFHRTDGSR
 
Nucleotide Sequence: 834 bp     [Download]
>gi|225871699|ref|NC_012483.1|:c3781088-3780255 Acidobacterium capsulatum ATCC 51196 chromosome, complete genome
ATGAAACCGCTCATTCCCGTTGCCGTCATTCTGTCCCTCACCTTTGCCTGTGCTTCGTCACGGGCCGCGA
CTCACCCTCCACAACCGCAGCCCAATCCGCCGCGCACGGTCATCGTGACTGCGACGGCAGCGCCGCCGGT
CATCGATACCGCCCTGCTTCAATCGACGTTGCTGATCCTGCCCCCGCAGGAAAAGGTCGCCAACGTCTTT
GCAGGCGACACGGTCGATTGGGTCATCGACGGCGGGCACGTCGCCAGCCGCTTTCTCAGTGTCAAGCCCA
AGACCGCGGGGGCCGAAACCGATATTCACATTATTTCGGACCACGGCAACGAGTACACGCTGGAGTTGCG
CGAGGTCTCCGGGGAGACCGACCCGCATTTTGATTCCAAGGTTTTCCTGGAGCCGGGCGATAAGGCCGCG
AAGGCCCGGCTCATTGAGTTGCCAATATTTGTGCCTGCGGCTGAGCTAAAAGCTGAAAAAGAAGAGTTAA
AGTCCGCGGAGGCCACGGAAGCCGCCGCCATTCGGAAGGAACGGGCGAAAGCGGAGGAATTCCGCAGTCA
ATATCCCGGCACGCTGCGCTTTGACTTCACTTGGAACAAATCCAAGGGCAATGCTCTGGGCCTTCACGAA
ATCTGGCATGACAGCAAATTTACTTACCTGCGCGGCGATTTTGAAGAGACGCCGGCGCTCTATGAAGTCA
AGGCCGGAAAGCCTTCGCTGATCAATTACGACTTCAACGACGGCCTGTACACCGTTCCGAAGGAACTGGC
TCGCGGCTATCTCATCATCGGCAAGCAGAAGGTGGAGTTCCACCGCACGGATGGGAGCCGCTAG
 Primer design