SecReT4
Protein ID: 226201069
T4SS name [ID]Tra_I [167]
Gene symboltraJ
Locus tagp026VIR_p130
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]115278..116426 [+]
Productplasmid transfer ATPase TraJ
Component typeTraJ_I
UniProt IDC1J8N0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-32, Aligned region: 144..292
Protein Sequence: 382 a.a.     [Download]
>gi|226201069|ref|YP_002756681.1| plasmid transfer ATPase TraJ [Escherichia coli]
MKLPDEFGTFPFARFTAEEFRYFFAWCARHRVSDIDLTGGSPVSVSRFGRRVRSSAHPLPSSIMMALSDE
LFGREVLPRVLSGHPVDRTIQVSGDASGRYGLQRGQRVRLRCHLIQGTSATEEKVISVTMRVIPSDIPDI
LTMNIEPDLLDAMLRKTGLGFICGETGSGKSTLAAALYRYIQTHFPDRKTVTYEDPVEYILGGENDLLPP
HQAEIGRDVESFAAGLRSAVRRNPDIIGIGEIRDYETADAAVQAGNTGHFCIGTMHTKSPGETFARLLGL
FPPEIRDSMAAATLSLVQFILVQVLVRTNDGGRQAVREYIVITDELRDTLSRQSHATWGHYIDEIIRKEK
RRIRDQVLTMYQTGSIEASEAALFIPAGEFPK
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|226200948|ref|NC_012487.1|:115278-116426 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAAATTACCCGATGAGTTCGGCACATTCCCTTTCGCCCGTTTCACGGCCGAAGAGTTTCGCTATTTTT
TTGCCTGGTGTGCCCGACACCGCGTCAGTGATATCGATCTGACAGGCGGCTCACCGGTATCTGTCAGTCG
CTTTGGACGGCGGGTACGTTCGTCCGCACATCCTCTGCCGTCCTCCATCATGATGGCGCTGAGTGATGAA
TTGTTTGGACGGGAAGTCCTTCCCCGGGTGCTGTCCGGTCATCCCGTGGACCGTACCATTCAGGTCAGCG
GTGATGCCTCCGGTCGCTACGGTCTGCAACGGGGGCAGCGTGTTCGCCTGCGCTGTCATCTGATTCAGGG
AACATCAGCAACAGAAGAAAAAGTAATCTCCGTCACCATGCGGGTGATCCCGTCCGATATTCCGGACATC
CTCACCATGAATATTGAACCGGACCTGCTGGATGCCATGCTCCGGAAAACCGGTCTGGGTTTCATCTGCG
GAGAGACCGGCTCCGGTAAATCCACACTGGCAGCGGCACTGTACCGCTACATTCAGACGCATTTCCCCGA
CCGCAAAACGGTGACCTATGAAGATCCGGTGGAATACATTCTGGGGGGAGAGAATGACCTTCTGCCACCC
CATCAGGCCGAAATCGGGCGTGATGTGGAAAGTTTTGCGGCAGGACTTCGCTCTGCCGTTCGCCGTAACC
CGGACATCATCGGTATCGGTGAAATCAGGGATTATGAAACGGCAGATGCAGCCGTCCAGGCAGGTAACAC
CGGTCACTTCTGCATCGGCACCATGCACACCAAATCACCCGGTGAAACCTTTGCCCGGCTGCTGGGGTTA
TTTCCACCGGAAATCAGGGATTCAATGGCAGCCGCCACCCTTTCCCTGGTGCAGTTCATTCTGGTGCAGG
TCCTGGTCAGAACAAATGACGGTGGCAGACAGGCCGTCCGGGAATACATCGTCATAACTGACGAACTGCG
TGATACGCTCTCCCGGCAGTCCCATGCGACATGGGGGCATTACATTGATGAAATCATTCGCAAGGAAAAA
CGGCGGATACGGGATCAGGTTCTGACCATGTATCAGACGGGCAGCATTGAGGCATCAGAAGCTGCGCTCT
TCATCCCGGCCGGAGAATTCCCCAAATGA
 Primer design