SecReT4
Protein ID: 226201072
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p133
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]120855..121205 [+]
ProductTraL
Component typeTraL_I
UniProt IDC1J8N3, B7LIR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|226201072|ref|YP_002756684.1| TraL [Escherichia coli]
MNMKKTLLVILTGITLASPVAGAATCRAGAAAEAGSRAAWERARTASQAWSQRENDVASSLQSCLSRIKD
ISITLPQFPSLDKLLRDLENQVCDAVVDRVNDHLPGNIDPWKDYNL
 
Nucleotide Sequence: 351 bp     [Download]
>gi|226200948|ref|NC_012487.1|:120855-121205 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAACATGAAAAAAACGCTGCTGGTCATACTGACCGGCATCACCCTGGCATCACCGGTGGCAGGTGCCG
CCACCTGCCGGGCGGGGGCCGCTGCCGAAGCCGGCAGCAGAGCCGCCTGGGAGCGGGCGCGCACAGCCAG
CCAGGCATGGTCACAGCGGGAGAATGACGTCGCCTCCTCCCTGCAGTCCTGCCTGTCCCGCATCAAGGAC
ATCAGTATCACTCTTCCGCAGTTCCCCAGCCTGGACAAGCTCCTCCGCGACCTGGAAAACCAGGTCTGTG
ATGCCGTCGTGGATCGGGTGAATGACCATCTTCCGGGGAATATCGACCCCTGGAAAGACTACAACCTCTG
A
 Primer design