SecReT4
Protein ID: 226201073
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p134
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]121217..121912 [+]
ProductTraM
Component typeTraM_I
UniProt IDC1J8N4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1e-33, Aligned region: 78..185
Protein Sequence: 231 a.a.     [Download]
>gi|226201073|ref|YP_002756685.1| TraM [Escherichia coli]
MSEAQPTSPVSPEADNSGDIYNPVLRTIAQSEQRAALVPGLVRALLYSGAALCISLVANGIQYWHATGVT
REYFATDNGRLVRLAPTSQPAWSQSDVMNFGSMTLSEAFNLDFVHYRKQITTQAPRFSEAGFAGYVNALQ
ASNILDTIKKEKFNLTTTIGAGTLVNQGQMENGVWFWKFQYPVRMRLVGQTSTRPEQAFTFEITVRRVDP
RIKPGGMEISQMVSRNAAAGI
 
Nucleotide Sequence: 696 bp     [Download]
>gi|226200948|ref|NC_012487.1|:121217-121912 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAGCGAAGCACAACCCACCTCCCCTGTCTCACCGGAAGCGGATAACAGCGGAGATATTTATAACCCCG
TGCTCAGAACCATCGCACAGTCAGAACAACGGGCCGCGCTGGTACCCGGTCTGGTCAGGGCGTTGCTGTA
CAGCGGCGCAGCACTCTGCATCAGCCTGGTGGCTAATGGCATACAGTACTGGCATGCCACCGGCGTGACG
CGCGAATACTTTGCCACTGACAATGGCCGACTGGTCCGTCTGGCACCAACCAGCCAGCCGGCCTGGAGTC
AGAGCGACGTCATGAACTTTGGCAGCATGACGCTGAGCGAAGCCTTCAATCTCGATTTTGTCCACTACCG
AAAACAAATCACGACACAGGCCCCCCGCTTTTCCGAAGCCGGCTTTGCCGGCTATGTGAATGCCCTTCAG
GCCTCGAACATTCTCGACACTATTAAAAAGGAGAAATTTAACCTCACAACCACTATCGGGGCAGGTACCC
TGGTCAACCAGGGACAGATGGAGAACGGCGTCTGGTTCTGGAAATTCCAGTATCCGGTCAGGATGCGCCT
GGTCGGTCAGACCAGCACCCGCCCCGAACAGGCCTTCACCTTTGAAATCACTGTCCGGCGCGTTGACCCC
CGCATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTCCCGTAACGCCGCAGCAGGAATCTGA
 Primer design