SecReT4
Protein ID: 226201082
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p143
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]127256..130300 [+]
ProductTraU
Component typeTraU_I
UniProt IDQ68JA2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.2e-42, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|226201082|ref|YP_002756694.1| TraU [Escherichia coli]
MNINRIIFAIEDCISTLSRYSVSAFFPDYCDLHTVIGLDQQDRERRPWLKAPYIATTKQGYYLSVFEISG
ALKEMDENPDQTAPGTLESLIAALAERMNTAWKNSGHKISFVFERDPERGRDEIEAMLLPQRKSIARTGI
LLQDVLDEKVTTLTPWLVRERCWLTVWSSEELLSRTDRKDHQTRVRKLAEHAPPARFAQDPWRWTLSALK
IRHDALLDTLEQALTHDSDGLLIRLMDIHEVGREIRRQLERNSTPAVWQPHLPEDARPAGWRQGGDTSVF
HAPSLNLQLFTTQPETHGSLIQAGELWHGMVAITLPPQNLRTFNQLVRDVPRAIPWRIRMDLMPDGMKAL
GVKKTLLTYSSFIPPLRPMYDSVMMLNDINKHDPVCIMTIVATTWGNSREVCTRNQALLKSALEGWGVCG
TTTTFGDPRRAWVNTVLAASHSSGPIPLYPPLSHALSLFPLNRAGSVWRGQGNLMMHTEDGSAWEVALAS
SQQNKHTELTPGAPGLGKSVLINALSEIQIASAQKNLPFIAYIDKGFSAQGLVQLIRDSLPEQRKDEAVG
IILSNDPDHTRNLFDVMYGARKPVTPEKNFMVSVLCALCVDTGTGQPCNPGDTRQIISSLVDLAFREYGE
NNPRLYRAGTEPLVDLALEESGIAEQHDAGWWNAATWFEIRDMLHIAGNIPAAQRAHYQAMPLLAEMSAL
LGQPSIRDVFGTVQRDNSEERLLDYIRRALDQGHSDYPMMSGCTRFMLSPDTRVVAVDLNNVAGDKTPAG
RLRTGIMYLLAGQIAGGDFVLPQYQEEIRKNLDPRYHEVIFRRIEQLDQEVKTKVYDELHNAKGINFIWE
ALDTQELEQRKFGIRTVLSTQLLQHYPPAVLKSANTLWLLRYRPDEIPFLRDNFGVPEVTLRRFLKMPEG
AAPDGSGVPVLAVFRVKNGTLARILKFTLGPLELWALNSSPKDSALRRALTQEVGSLRARQILAEHFPRG
SATSLIEHRARTHDSENVIHELAAELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|226200948|ref|NC_012487.1|:127256-130300 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAATATCAACCGCATTATTTTTGCCATTGAAGACTGTATCAGTACCCTGTCACGGTATTCCGTTTCCG
CATTCTTCCCCGATTACTGTGATCTGCACACCGTCATCGGTCTGGACCAGCAGGACCGCGAACGCCGCCC
CTGGCTGAAAGCCCCCTACATTGCCACCACAAAACAGGGGTATTACCTTTCCGTCTTTGAAATCAGCGGT
GCCCTGAAAGAAATGGATGAAAACCCGGACCAGACGGCCCCCGGGACACTGGAGTCACTGATTGCAGCAC
TGGCTGAGCGAATGAACACGGCCTGGAAAAATTCCGGCCACAAAATCAGTTTTGTTTTCGAACGCGATCC
GGAGCGTGGAAGGGATGAAATCGAAGCCATGCTCTTACCCCAGCGAAAATCCATCGCACGCACGGGGATC
CTGCTTCAGGACGTCCTGGATGAAAAAGTCACCACACTCACCCCCTGGCTTGTCCGGGAGCGCTGCTGGC
TGACCGTCTGGAGCTCTGAAGAACTGCTGAGCCGGACCGATCGCAAGGACCATCAGACCCGTGTCAGGAA
ACTAGCTGAACACGCTCCGCCAGCCCGTTTTGCGCAGGATCCCTGGCGCTGGACACTTTCCGCCCTCAAA
ATACGGCATGACGCCTTACTGGACACGCTGGAGCAGGCCCTGACACATGATTCTGATGGCCTGCTGATTC
GCCTGATGGATATCCATGAAGTGGGACGGGAAATCCGCCGCCAGCTGGAGCGCAACAGTACACCGGCAGT
ATGGCAGCCTCATCTGCCTGAAGATGCCCGTCCTGCCGGCTGGCGACAGGGCGGGGATACCTCTGTATTC
CACGCACCGTCGCTGAATCTGCAGTTATTCACCACACAGCCTGAAACACACGGCAGCCTGATTCAGGCCG
GTGAGCTCTGGCACGGTATGGTCGCCATTACCCTGCCCCCTCAGAATCTGCGGACATTCAACCAGCTGGT
CAGGGATGTGCCCCGTGCAATCCCCTGGCGTATCCGGATGGATCTGATGCCCGACGGCATGAAGGCGCTG
GGGGTCAAGAAAACCCTGCTGACCTACAGCAGCTTTATTCCTCCTCTCCGGCCCATGTATGACTCGGTAA
TGATGCTGAATGACATCAACAAGCATGATCCGGTCTGTATCATGACCATTGTTGCCACCACATGGGGAAA
CAGCCGGGAAGTCTGTACCCGTAACCAGGCTCTCCTGAAATCTGCGCTGGAAGGCTGGGGGGTATGCGGC
ACCACCACCACCTTCGGTGATCCGAGACGTGCCTGGGTGAACACGGTTCTGGCAGCCTCCCATAGCTCCG
GCCCGATCCCCCTTTACCCGCCCCTTTCACACGCCCTTTCCCTGTTTCCCCTGAACAGGGCAGGCTCTGT
CTGGCGGGGACAGGGAAATCTGATGATGCACACCGAAGACGGCTCTGCATGGGAGGTGGCGCTGGCGTCA
TCACAACAGAACAAGCACACGGAGCTGACACCCGGCGCACCCGGTCTGGGCAAATCGGTACTCATCAACG
CACTGTCGGAGATCCAGATAGCCTCAGCCCAGAAGAATCTCCCTTTCATTGCCTATATCGACAAGGGATT
CAGTGCACAGGGACTGGTACAGCTTATCCGTGACAGCCTGCCTGAGCAGAGAAAGGACGAAGCCGTGGGG
ATCATTCTGAGTAATGACCCGGACCACACCCGCAACCTGTTTGATGTGATGTACGGGGCCAGAAAACCCG
TCACACCGGAAAAGAACTTCATGGTCTCCGTCCTCTGTGCATTGTGTGTGGATACCGGCACCGGTCAGCC
CTGTAATCCCGGCGACACCCGGCAAATCATCAGCAGCCTGGTGGACCTGGCCTTCCGGGAATATGGCGAG
AATAACCCCAGACTTTACCGCGCAGGTACGGAACCCCTGGTGGATCTCGCCCTGGAAGAGAGCGGCATCG
CTGAACAACATGATGCCGGATGGTGGAATGCCGCCACCTGGTTTGAAATCAGGGACATGCTGCATATTGC
AGGGAATATCCCCGCCGCCCAGCGGGCACACTACCAGGCCATGCCCCTGCTGGCTGAAATGTCCGCCCTG
CTGGGACAGCCGTCCATCCGGGATGTGTTCGGCACCGTTCAGCGTGATAACTCGGAAGAGCGGTTGCTGG
ACTACATCCGCCGTGCCCTCGATCAGGGACACAGTGACTACCCGATGATGTCCGGCTGTACCCGGTTTAT
GCTCAGCCCCGACACCCGCGTGGTCGCCGTTGATCTGAACAATGTGGCCGGGGACAAGACACCTGCCGGA
CGTCTGCGCACCGGTATCATGTATCTGCTGGCCGGGCAGATCGCCGGCGGGGATTTTGTCCTGCCGCAGT
ATCAGGAGGAAATACGGAAAAATCTCGACCCACGCTACCATGAGGTGATTTTCCGCCGCATTGAACAGCT
TGATCAGGAGGTCAAGACCAAAGTCTATGACGAACTGCACAATGCAAAAGGGATCAACTTCATCTGGGAA
GCCCTGGACACCCAGGAGCTGGAGCAGCGTAAGTTCGGGATACGCACGGTGCTGAGCACCCAGCTGCTGC
AGCATTATCCTCCGGCCGTGCTCAAATCCGCCAACACCCTGTGGCTGCTGCGTTACCGCCCTGACGAAAT
TCCGTTCCTGCGGGATAACTTTGGCGTCCCGGAAGTCACACTGCGGCGCTTCCTGAAAATGCCGGAAGGG
GCCGCACCGGACGGCAGCGGTGTCCCGGTACTGGCTGTGTTCCGTGTAAAAAACGGCACGCTGGCCCGGA
TCCTGAAATTCACCCTCGGTCCACTGGAGCTGTGGGCACTGAACTCCTCTCCTAAAGACAGCGCCCTGCG
ACGTGCGCTGACGCAGGAGGTGGGGTCACTGCGGGCACGCCAGATCCTGGCCGAACACTTTCCCCGGGGT
TCAGCCACCTCACTGATAGAACACCGCGCCCGCACACATGACAGTGAAAACGTCATCCATGAGCTGGCAG
CAGAACTCATCCGTAAGCAGGGATATAACCTCTGA
 Primer design