SecReT4
Protein ID: 226807762
T4SS name [ID]Tra_F [572]
Gene symbol-
Locus tagpEC-IMP_196
StrainEnterobacter cloacae plasmid pEC-IMP (NC_012555)
Repliconplasmid pEC-IMP [GenBank: NC_012555] [Browse all T4SS(s) in this replicon]
Location [Strand]208328..209374 [-]
ProductTrhF
Component typeTraF_F
UniProt IDC1IUU1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-50, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.6e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|226807762|ref|YP_002791458.1| TrhF [Enterobacter cloacae]
MTRIALAPSKMVLLMSLVITGAHASPEQPLIKDTPFVSGQAYKKGFFWYDDPAKKSEAEEEEVLPPTGAA
SSPSKEEMVDLNSKWLKENMPRLLTQAMDNPTAENLSRYYTAQRLMLDISTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQTVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMQNYYSVDILPISMDG
RPLHNGLFQDFNIPNAQIIDQFKIREVPTIFLVSKDGTSAQRISEGMISADELKNTIILAAKGMNLIDDA
SFQSTLDIKRQYTIGDDGVITVNKSEMESDPFLLQKIMDQKLEGYDMPTADPVNYLNAGGSFGGTYAQ
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|226807567|ref|NC_012555.1|:c209374-208328 Enterobacter cloacae plasmid pEC-IMP, complete sequence
ATGACTCGTATTGCATTAGCGCCTTCAAAGATGGTTTTGCTTATGTCTTTGGTAATTACTGGTGCCCACG
CCAGCCCTGAGCAACCCCTAATAAAAGATACGCCCTTTGTATCTGGCCAGGCTTATAAGAAGGGTTTCTT
CTGGTATGACGATCCTGCTAAAAAAAGCGAAGCTGAAGAAGAAGAGGTTTTGCCACCAACCGGTGCTGCT
AGCTCGCCTTCAAAAGAGGAAATGGTAGATTTAAATTCAAAATGGCTAAAAGAGAATATGCCTCGACTGT
TAACGCAGGCAATGGATAACCCTACCGCAGAAAATCTATCACGTTATTACACGGCGCAAAGGTTAATGCT
GGATATCAGTACGCGTTTTTCTGACAAATCAAAAGATTATTTTCTTAAAAACCCGATGATGTCTGAAAAA
CGCAGGCAACCAGTGGAAAAGGTGGCACTGGATGCTCACCGCACTGTTGTTGAAAAAAATCAGCAAACGG
TAATGAAAGATATCTTTACTAAGTCAGGTTTATTTTTCTTTTTCCAGAGTACTTGCCAGTTTTGCCACGA
AGAAAGCCAAATACTTCAATTTATGCAGAACTATTATTCGGTAGATATTCTTCCAATCAGTATGGATGGA
AGGCCATTGCATAATGGCCTTTTTCAGGATTTTAACATCCCCAACGCACAAATTATTGATCAATTTAAAA
TTCGAGAGGTACCTACAATTTTCCTGGTTTCAAAGGATGGGACATCAGCTCAGCGCATTAGTGAAGGCAT
GATCTCCGCTGATGAATTAAAGAACACTATTATACTTGCCGCGAAGGGCATGAATCTGATCGATGACGCT
TCGTTCCAGTCAACTCTAGATATTAAAAGGCAATATACCATCGGCGATGATGGCGTTATTACCGTTAATA
AATCCGAAATGGAATCAGACCCATTCCTACTTCAAAAAATAATGGACCAAAAACTCGAAGGCTATGACAT
GCCTACGGCCGATCCGGTCAATTATCTCAATGCTGGCGGCAGTTTTGGAGGCACTTATGCGCAGTAA
 Primer design