SecReT4
Protein ID: 226809880
T4SS name [ID]Tra_F [571]
Gene symbol-
Locus tagpEC-IMPQ_003
StrainEnterobacter cloacae plasmid pEC-IMPQ (NC_012556)
Repliconplasmid pEC-IMPQ [GenBank: NC_012556] [Browse all T4SS(s) in this replicon]
Location [Strand]2396..2746 [+]
ProductTrhL
Component typeTraL_F
UniProt IDC1IU97
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.6e-06, Aligned region: 22..92
Protein Sequence: 116 a.a.     [Download]
>gi|226809880|ref|YP_002791574.1| TrhL [Enterobacter cloacae]
MRGFIPLSGFLMSKQNDVPQHTYRFPFRINMPLLILFWDAKKLGLAFILVAFGNIFECFGFSVVAAVVYW
IAYNKAAESGIRGLLKHKLWWLGFLPGKAVFSSRYFNDPFIRDLYS
 
Nucleotide Sequence: 351 bp     [Download]
>gi|226809877|ref|NC_012556.1|:2396-2746 Enterobacter cloacae plasmid pEC-IMPQ, complete sequence
ATGAGGGGGTTCATCCCCCTCTCTGGATTTTTAATGAGTAAGCAGAACGACGTTCCTCAGCATACCTATA
GATTCCCTTTCAGGATCAACATGCCTCTACTGATTTTGTTTTGGGATGCCAAAAAATTAGGGCTTGCATT
CATTCTGGTTGCATTTGGGAATATCTTCGAATGCTTCGGGTTTTCTGTTGTAGCAGCGGTTGTGTATTGG
ATTGCGTATAACAAAGCAGCTGAGTCAGGAATAAGAGGATTGCTAAAACACAAACTCTGGTGGCTCGGTT
TTTTGCCAGGTAAAGCAGTTTTTAGTAGCCGTTATTTCAACGATCCATTTATCAGAGATTTGTATTCTTG
A
 Primer design