SecReT4
Protein ID: 226945613
T4SS name [ID]Trb [296]
Gene symboltrbG
Locus tagAvin_35640
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3636078..3636974 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDC1DR53
KEGG IDavn:Avin_35640
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-66, Aligned region: 68..287
Protein Sequence: 298 a.a.     [Download]
>gi|226945613|ref|YP_002800686.1| trbG gene product [Azotobacter vinelandii DJ]
MQAQPLPEPPKPVEVVAVPEPLALPAQLKPLPEVDEATPVPEPADEKVRVSRANAEARIAPTREGYVNAI
QVWPFTDGALYQVYASVGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGSGDALRVNVLVKPIRSGLKT
NLVITTSRRTYLLELTSTERAWMASVSWDYPKDRMLALLRQAQAASAAAPVDTGLSLENIRFRYAVSGSN
PPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDGG
DVVRIERTDGVVSRSGRN
 
Nucleotide Sequence: 897 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c3636974-3636078 Azotobacter vinelandii DJ chromosome, complete genome
GTGCAGGCGCAGCCGCTGCCCGAACCGCCCAAGCCGGTGGAAGTCGTCGCCGTGCCCGAGCCGCTGGCGC
TGCCGGCGCAGTTGAAGCCGCTGCCGGAGGTGGACGAGGCCACACCCGTACCGGAGCCGGCCGACGAGAA
GGTGCGTGTCTCGCGCGCCAACGCCGAGGCGCGCATCGCGCCGACCCGAGAGGGCTACGTCAATGCGATT
CAGGTGTGGCCCTTCACCGATGGCGCGCTCTATCAGGTCTATGCGTCCGTGGGCCGCGTGACCGTGATCG
CGCTCCAACCAGGTGAGGAACTGGTGACGGTGGCCGCAGGCGATACCGTGCGCTGGATCGTCGGCGACAC
ATCCAGCGGCAGCGGCGATGCGCTGCGCGTGAACGTGCTGGTCAAGCCCATCCGCTCGGGCCTGAAAACC
AATCTGGTCATCACCACCAGCCGCCGGACGTACCTGCTGGAGCTGACCTCAACGGAAAGGGCGTGGATGG
CGTCGGTGTCCTGGGACTACCCGAAAGACCGGATGCTGGCCTTGCTGCGCCAGGCGCAGGCGGCCAGCGC
CGCCGCGCCGGTCGATACCGGCCTGTCGCTGGAGAATATCCGCTTCCGCTACGCGGTGTCAGGCAGTAAT
CCGCCGTGGAAACCGCTGCGCGCCTTCGATGACGGCGAGAAGGTCTATATCCAGTTCCCGCCGGGTATCG
CCCAAGGCGAGCTGCCACCGCTGTTCGTCATCGGCGCGCAGGGCGACGGGCAACTGGTGAACTACCGTTT
CCGCTCGCCGTACTACATCGTGGATCGGCTGTTCGGCGCGGCCGAACTGCGCCTGGGCGGTGATGGTGGC
GACGTGGTTCGGATCGAGCGCACGGATGGCGTCGTATCAAGGAGTGGGAGGAACTGA
 Primer design