SecReT4
Protein ID: 226945615
T4SS name [ID]Trb [296]
Gene symboltrbL
Locus tagAvin_35660
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3637811..3639184 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDC1DR55
KEGG IDavn:Avin_35660
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.9e-49, Aligned region: 37..264
Protein Sequence: 457 a.a.     [Download]
>gi|226945615|ref|YP_002800688.1| trbL gene product [Azotobacter vinelandii DJ]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLAGIVFRSFAGLGLTATGSAITMENFLQPGRLAKTGIDAGAPILEQIGDMAGFPEVF
TNIDPIVVMFLAWLVVTLCFFVLAVQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGVK
VLVLAVIVGIGSGLFAEFQTVPDEPSIDHALVVMLASLSLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAVGTGVAIGAAATGVGGAVMAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGDGAKGATAG
LGNVAKTGVQAAGRRAASGASAAGQKMAGSFRAGWNGADAGAAGSGQAAAGEGANSAASAPKQEQPAWAK
RMHRRQQITHAATTTAHTLRGGDGGGSGQGPSLRSDE
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c3639184-3637811 Azotobacter vinelandii DJ chromosome, complete genome
ATGAACGACGTGACCATCATCGATCGCTTCCTCGACACGTTCTCGCGCTACATCGACTCGGGCTTCGGTC
TGTTGCAGGGCGAAGTGGCGTTCCTGACCGCCACGCTCATCGTCATCGACATGACGATCGCCGGCCTGTA
CTGGGCCATGAGCCACGCGACCGGCCAGGGCGAAGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGCGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCCGGCATCGTATTCCGCTCGTTCGCCG
GCCTGGGCCTGACGGCCACCGGCTCGGCCATCACGATGGAGAACTTCCTGCAACCGGGACGGCTGGCGAA
AACCGGCATCGACGCGGGTGCGCCGATTCTGGAGCAGATCGGCGACATGGCCGGGTTCCCCGAAGTGTTC
ACGAACATCGACCCGATCGTGGTGATGTTCCTCGCGTGGCTGGTCGTCACCCTCTGCTTCTTCGTGCTGG
CGGTGCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTGCTGGTGCCGTT
CGCGCTCTGGAACAAGACGAGCTTCCTGGCGGAAAAGGTGCTCGGCAACGTGGTGTCGTCTGGCGTCAAG
GTACTGGTGCTGGCCGTCATCGTCGGCATCGGTTCGGGCCTGTTCGCCGAGTTCCAGACCGTGCCGGATG
AACCGTCCATCGACCATGCCCTGGTCGTGATGCTGGCTTCGCTCTCGCTGCTGGCCTTGGGCATCTTCGG
GCCGGGTATCGCCACGGGCCTCGTGTCGGGTGCACCGCAGCTTGGCGCGGGCGCGATGGCCGGCGCCGCT
GTCGGCGCTGTCGGCACGGGCGTTGCCATTGGCGCCGCCGCAACTGGCGTGGGCGGTGCGGTCATGGCCG
GGGCGCGCATGGCGCCGGCGGCCGCCAAGCTGGCCGGCAGCGGCGCACGCGCCGCCACGTCGGCGGCCAG
CAGCGCCAAGTCGGCATTCCAGGCCGGTTCCGCCGCTGCGGGCGACGGGGCCAAGGGGGCGACTGCCGGC
CTCGGCAATGTCGCCAAGACCGGCGTACAGGCGGCAGGCCGCCGTGCCGCGTCCGGAGCTTCCGCTGCCG
GGCAGAAGATGGCCGGTTCCTTCCGTGCCGGCTGGAACGGCGCGGATGCCGGCGCCGCCGGCTCCGGCCA
GGCCGCCGCAGGCGAAGGTGCAAACAGCGCCGCCAGCGCACCGAAGCAGGAACAACCCGCCTGGGCCAAG
CGGATGCACCGCCGCCAGCAAATCACCCATGCCGCGACTACTACCGCCCACACGCTGCGCGGTGGCGACG
GCGGCGGCTCGGGGCAAGGCCCGAGCCTGCGCTCCGATGAATGA
 Primer design