SecReT4
Protein ID: 226945620
T4SS name [ID]Trb [296]
Gene symboltrbC
Locus tagAvin_35710
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3642974..3643258 [-]
ProductP-type conjugative transfer protein TrbC
Component typeTrbC
UniProt IDC1DR60
KEGG IDavn:Avin_35710
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-22, Aligned region: 1..84
Protein Sequence: 94 a.a.     [Download]
>gi|226945620|ref|YP_002800693.1| trbC gene product [Azotobacter vinelandii DJ]
MLAAIMLMTAGTAQAAGSSMPWEGPLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVF
GLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 285 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c3643258-3642974 Azotobacter vinelandii DJ chromosome, complete genome
ATGCTGGCCGCCATCATGTTGATGACGGCCGGCACGGCGCAGGCCGCCGGTTCCTCGATGCCCTGGGAAG
GGCCGCTGCAATCCATCCTGGAGTCGATCCAGGGGCCGGTTGCACGCATCGTCGCCGTCATCATCATCAT
TGCCACGGGCCTGGCGCTCGCCTTCGGCGACACCAGCGGCGGCTTTCGCAAGCTGATCCAGATCGTCTTC
GGCCTGTCCATCGCGTTCGCCGCGTCGTCGTTCTTCCTGTCCTTCTTCAGCTTCTCCGGCGGGGCGGTCG
TATGA
 Primer design