SecReT4
Protein ID: 226945669
T4SS name [ID]Tfc [755]
Gene symbol-
Locus tagAvin_36200
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3686878..3687234 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDC1DRA9
KEGG IDavn:Avin_36200
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.1e-30, Aligned region: 32..110
Protein Sequence: 118 a.a.     [Download]
>gi|226945669|ref|YP_002800742.1| unnamed protein product [Azotobacter vinelandii DJ]
MNRYPLLLASPCRLARHGLLAIAGCVLVAPQANAASASEQAHIEVMIRQLNALEESARRSARIADEPGQR
YFFDYRRLATDIQRIRQGLQDYLTPSRAQPRDPADLSGSYTLNGGRMP
 
Nucleotide Sequence: 357 bp     [Download]
>gi|226942170|ref|NC_012560.1|:3686878-3687234 Azotobacter vinelandii DJ chromosome, complete genome
GTGAATCGCTATCCGCTCCTCCTTGCCTCTCCCTGTCGACTGGCCCGCCACGGCCTGCTCGCCATCGCCG
GCTGCGTGCTGGTCGCACCCCAGGCGAACGCCGCGAGTGCGTCCGAGCAGGCCCACATCGAGGTCATGAT
CCGCCAGTTGAATGCCCTGGAGGAGTCGGCCAGGCGCAGCGCCCGGATCGCCGACGAGCCAGGCCAGCGC
TACTTCTTCGACTACCGGCGCCTGGCCACCGACATCCAGCGTATCCGCCAGGGCCTCCAGGACTATCTCA
CCCCCAGCCGTGCCCAGCCCAGGGACCCGGCCGATCTCTCGGGCAGCTACACGCTCAACGGAGGCCGGAT
GCCATGA
 Primer design