SecReT4
Protein ID: 226945671
T4SS name [ID]Tfc [755]
Gene symbol-
Locus tagAvin_36220
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3687489..3687833 [+]
Producthypothetical protein
Component typeTfc10
UniProt IDC1DRB1
KEGG IDavn:Avin_36220
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 6.6e-34, Aligned region: 27..113
Protein Sequence: 114 a.a.     [Download]
>gi|226945671|ref|YP_002800744.1| unnamed protein product [Azotobacter vinelandii DJ]
MPKKTKTLRHIAIAVALAVPQLTFAALPQAQAPSRGEGTNIIQTLQNYGYDGAMLLALLLLAAMFLGVAA
HAYGVYHEIHEGKKKWRDLGATAAVGVCIIGVGIFLATRATNIL
 
Nucleotide Sequence: 345 bp     [Download]
>gi|226942170|ref|NC_012560.1|:3687489-3687833 Azotobacter vinelandii DJ chromosome, complete genome
ATGCCCAAGAAAACGAAAACCCTTCGCCACATCGCTATCGCGGTTGCCCTGGCTGTTCCCCAGTTGACGT
TCGCGGCCCTGCCACAAGCCCAGGCCCCGTCTCGCGGCGAAGGGACGAACATCATCCAGACGCTGCAGAA
CTACGGCTACGACGGGGCGATGCTGCTTGCGCTGCTGTTGCTCGCGGCCATGTTCCTGGGCGTCGCGGCC
CATGCCTACGGGGTCTACCACGAGATCCACGAAGGCAAGAAGAAGTGGCGCGACCTCGGCGCGACCGCGG
CCGTCGGCGTCTGCATCATCGGGGTCGGCATCTTCCTGGCAACCCGGGCCACCAACATTCTCTGA
 Primer design