SecReT4
Protein ID: 226945672
T4SS name [ID]Tfc [755]
Gene symbol-
Locus tagAvin_36230
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3687846..3688238 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDC1DRB2
KEGG IDavn:Avin_36230
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.7e-43, Aligned region: 11..128
Protein Sequence: 130 a.a.     [Download]
>gi|226945672|ref|YP_002800745.1| unnamed protein product [Azotobacter vinelandii DJ]
MVEEHDSLLADGTLRFLPIRLNNQPVVIGGLTADEMWATLVASAGAGLALGVPVAILAGNLALVLAGGLL
GGVFGLAVASRILRRMKRGRPDTWFYRQVQLTLAQRLPALNSHRLIVRSGAWSCRRTERT
 
Nucleotide Sequence: 393 bp     [Download]
>gi|226942170|ref|NC_012560.1|:3687846-3688238 Azotobacter vinelandii DJ chromosome, complete genome
ATGGTCGAAGAGCATGACAGCCTGCTCGCGGACGGGACGCTACGCTTCCTGCCGATCCGTCTGAACAACC
AACCCGTGGTGATCGGTGGGCTCACCGCCGACGAGATGTGGGCCACCCTCGTCGCCAGCGCGGGTGCCGG
GCTCGCCCTCGGCGTGCCGGTGGCGATCCTCGCCGGCAACCTGGCCCTGGTCCTGGCCGGCGGGCTGCTG
GGCGGCGTCTTCGGCCTGGCGGTGGCCAGCCGCATCCTGCGCCGGATGAAGCGCGGCCGGCCGGACACCT
GGTTCTACCGGCAGGTCCAGCTCACCCTCGCCCAGCGCCTGCCCGCCCTGAACAGCCACCGGCTCATCGT
GCGCTCCGGCGCCTGGAGCTGTCGTCGCACGGAGCGCACATGA
 Primer design