SecReT4
Protein ID: 226945685
T4SS name [ID]Tfc [755]
Gene symbol-
Locus tagAvin_36360
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T4SS(s) in this replicon]
Location [Strand]3700014..3701378 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDC1DRC5
KEGG IDavn:Avin_36360
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 454 a.a.     [Download]
>gi|226945685|ref|YP_002800758.1| unnamed protein product [Azotobacter vinelandii DJ]
MKRITQAAGLAGLALSLSGATALAVDPIKVEAQGSVIGDDVLYNIGGGSAVTMGSAGQMESITVGMGWQN
NLICGNMSLSNTLENQLNGATNGFQTIMSTVIQNVTGAVSSLPALALQRSNPALYNLLTNGILQARLDYD
RSKGACRSLVERMADIAGNQMGWGTVAQAQKMGQALSTSADAVEVVDKSESAPGSGGVTWVGGTQAGGAG
QQPIRVVGDVTRAGYNQLNRRSPTNTSSIPADSCANGLVCGYWESPAEAAAFGNRVLGEQQIRTCEGCAS
ESTPGVGLTLLIQETYDEKIKAIEELLKPGTEITDEKLRQASSDSLPVTRGVIAALRDERDQKVLAQRLA
SEVALSEVLGQALLLTRLLNSGAREPNVAANALAVSAVGQQTAVLQKEIDNLKMELDLRRELSKNSPLAI
VERGQSRTENSRSVLPAAPETDRLQQLQKSSAKE
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|226942170|ref|NC_012560.1|:3700014-3701378 Azotobacter vinelandii DJ chromosome, complete genome
ATGAAACGCATCACCCAAGCAGCGGGCCTGGCGGGCCTCGCGCTCAGCCTGAGCGGCGCGACGGCCCTGG
CGGTCGATCCCATCAAGGTCGAAGCCCAGGGCAGCGTCATCGGCGACGACGTGCTCTACAACATCGGCGG
CGGGAGTGCCGTGACGATGGGCAGCGCCGGGCAGATGGAAAGCATCACCGTGGGGATGGGCTGGCAGAAC
AACCTCATCTGCGGAAACATGAGCCTGAGCAACACCCTGGAGAACCAGCTCAACGGCGCGACCAACGGTT
TCCAGACCATCATGAGCACGGTGATCCAGAACGTCACCGGAGCGGTCTCCTCCCTGCCCGCGCTGGCCCT
GCAGCGTTCCAACCCGGCCCTGTACAACCTGCTCACCAACGGCATCCTGCAGGCGCGCCTGGACTACGAC
CGCTCCAAGGGGGCCTGCCGCTCGCTCGTCGAGCGCATGGCCGACATCGCCGGCAACCAGATGGGCTGGG
GAACCGTCGCCCAGGCCCAGAAGATGGGCCAGGCCCTGTCCACCAGCGCCGACGCGGTCGAGGTGGTGGA
CAAGTCCGAGAGCGCGCCCGGCAGCGGCGGCGTCACCTGGGTCGGCGGCACCCAGGCCGGCGGTGCCGGC
CAGCAGCCGATCCGCGTGGTCGGCGACGTGACCAGGGCCGGCTACAACCAGCTCAACCGGCGCTCGCCCA
CCAACACCTCGAGCATTCCGGCGGATAGCTGCGCCAACGGACTGGTCTGCGGCTACTGGGAGTCGCCGGC
GGAAGCCGCCGCGTTCGGCAACCGCGTGCTCGGCGAGCAGCAGATCAGGACCTGCGAGGGCTGTGCCAGC
GAATCGACGCCGGGGGTGGGCCTGACGCTGCTCATCCAGGAAACCTACGACGAGAAGATCAAGGCGATCG
AAGAGCTTCTCAAGCCGGGTACCGAAATCACCGACGAGAAGCTGCGCCAGGCCAGCAGCGACTCGCTGCC
CGTCACCCGCGGGGTGATCGCCGCCCTGCGCGACGAACGCGACCAGAAGGTACTCGCCCAGCGCCTGGCC
TCGGAAGTCGCCTTGTCCGAGGTCCTCGGCCAAGCGTTGTTGCTGACGCGCCTGCTGAACTCCGGCGCAC
GCGAGCCGAACGTGGCCGCGAACGCGCTGGCCGTGAGCGCGGTGGGGCAGCAGACCGCGGTCCTGCAGAA
GGAGATCGACAACCTGAAGATGGAGCTGGACCTGCGCCGCGAACTCTCCAAGAACTCGCCGCTGGCGATC
GTCGAACGCGGCCAGAGCCGGACCGAGAACTCCCGTTCCGTCCTGCCGGCCGCCCCTGAAACCGACCGTC
TGCAGCAACTGCAGAAGTCGTCCGCCAAGGAGTGA
 Primer design