SecReT4
Protein ID: 227819267
T4SS name [ID]VirB [224]
Gene symbolvirB7
Locus tagNGR_b10320
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234b [GenBank: NC_012586] [Browse all T4SS(s) in this replicon]
Location [Strand]996195..996524 [+]
ProductVirB7 type IV secretion related protein
Component typeVirB7
UniProt IDC3KQX7
KEGG IDrhi:NGR_b10320
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 109 a.a.     [Download]
>gi|227819267|ref|YP_002823238.1| VirB7 type IV secretion related protein [Sinorhizobium fredii NGR234]
MRNGLTTGFFANDSKGNIIMIRIALFLCVASTVSGCTTLSQPLPKCDGYSRRPLNRSMWQWQQDDVLKGP
HSGLTPTEPASLRSSYAEEGPADPQSNFDLMGSYLSCAG
 
Nucleotide Sequence: 330 bp     [Download]
>gi|227818258|ref|NC_012586.1|:996195-996524 Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence
ATGCGCAACGGCCTGACGACGGGCTTTTTCGCAAATGATAGCAAGGGCAACATCATCATGATCCGCATTG
CGCTCTTCTTATGCGTCGCATCGACCGTCAGCGGATGCACGACGCTTTCGCAGCCTCTGCCCAAGTGTGA
CGGGTATTCCCGGCGGCCGCTCAATCGTTCGATGTGGCAATGGCAGCAGGACGACGTCCTCAAGGGTCCC
CACTCAGGTCTGACGCCCACGGAGCCGGCAAGCCTGAGATCGTCCTATGCCGAGGAGGGGCCGGCGGACC
CGCAATCGAACTTCGATTTGATGGGCTCCTACCTTTCTTGCGCGGGGTAG
 Primer design