SecReT4
Protein ID: 227819268
T4SS name [ID]VirB [224]
Gene symbolvirB8
Locus tagNGR_b10330
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234b [GenBank: NC_012586] [Browse all T4SS(s) in this replicon]
Location [Strand]996528..997199 [+]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDC3KQX8
KEGG IDrhi:NGR_b10330
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-64, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|227819268|ref|YP_002823239.1| VirB8 type IV secretion protein [Sinorhizobium fredii NGR234]
MVTADSLKSYFDKARRFDQDRMIMAERSVRIAWFAAMIAGILAAASIFAVVALIPLKTIEPFVIRVDNST
GIVDVVSALDSAQGTYDEAVTKYFAAKYVRGREGYVWSEAEENFRTVALLSSEAEQSRFAAAYRGSNPGS
PQNIYGRSATSKIAIASISLINRQVASVRYIRTVTRGEEVLTTHWVATLTFDYVNAPMNATDRLVNPLGF
AISEYRADPETIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|227818258|ref|NC_012586.1|:996528-997199 Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence
ATGGTCACGGCCGACAGTCTCAAGAGCTATTTCGACAAGGCGCGCCGTTTCGATCAGGACCGGATGATCA
TGGCCGAACGCTCCGTGCGCATCGCCTGGTTCGCGGCAATGATCGCCGGCATCCTTGCTGCTGCCTCGAT
CTTTGCCGTGGTTGCCCTGATACCGCTAAAGACGATCGAACCCTTCGTCATCCGGGTCGATAATTCAACC
GGCATCGTCGACGTCGTCTCGGCACTGGACTCGGCGCAGGGGACCTATGACGAGGCCGTCACCAAATACT
TCGCCGCCAAATATGTGCGCGGCCGTGAAGGCTATGTCTGGAGCGAGGCGGAGGAAAACTTTCGCACCGT
CGCGCTCCTGTCGAGCGAGGCCGAGCAGTCGCGCTTTGCCGCAGCCTACCGCGGCAGCAATCCGGGTTCG
CCCCAGAACATATACGGGCGCAGCGCCACGTCGAAGATCGCAATAGCCTCGATCTCGCTGATCAACCGCC
AGGTCGCCTCCGTCCGGTACATTCGAACCGTGACGCGCGGCGAGGAGGTTCTAACCACCCATTGGGTGGC
AACGCTCACCTTCGACTATGTCAACGCCCCGATGAATGCGACCGACCGTCTGGTCAATCCGCTTGGCTTC
GCGATCAGCGAGTACAGGGCAGATCCGGAGACGATCAATTGA
 Primer design