SecReT4
Protein ID: 227819271
T4SS name [ID]VirB [224]
Gene symbolvirB11
Locus tagNGR_b10360
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234b [GenBank: NC_012586] [Browse all T4SS(s) in this replicon]
Location [Strand]999242..1000237 [+]
ProductVirB11 type IV secretion protein
Component typeVirB11
UniProt IDC3KQY1
KEGG IDrhi:NGR_b10360
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.6e-83, Aligned region: 15..316
AAA_17 [PF13207], Evalue: 4.8e-05, Aligned region: 166..224
Protein Sequence: 331 a.a.     [Download]
>gi|227819271|ref|YP_002823242.1| VirB11 type IV secretion protein [Sinorhizobium fredii NGR234]
MAEAPDAGVVRELLSPLSSFLQDDSLYEVVVNRPREVLTEGAGGWVRHGAPELTFEKLIRLARAVATYSN
QAIDDQRPILSATLPDEERIQIVIPPATSKGTVSITIRKPASVAVSLEDLERQGLFSQTTPGGDELQSSD
HGLLELHKAGAYTEFLRKAVLARKNIIISGATGSGKTTLSKALIRYIPDHERILSIEDTPELVIPQPNHV
RLFYSKDGQGVAKIGAKELLESCLRMRPDRILLQELRDGTAFYFIRNVNSGHPGSITTVHADSTKLAFEQ
LTLLVKESDGGKDLERQDIMSLLRIAIDVVVQCKRIHGRFHVTEIYFDAKC
 
Nucleotide Sequence: 996 bp     [Download]
>gi|227818258|ref|NC_012586.1|:999242-1000237 Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence
ATGGCGGAGGCGCCTGACGCAGGTGTCGTGCGTGAGCTGCTTTCGCCGCTCTCGAGCTTTCTCCAAGACG
ATTCGCTCTATGAAGTCGTGGTGAACCGGCCGCGCGAAGTGCTGACAGAAGGCGCCGGCGGATGGGTGAG
GCATGGTGCACCCGAACTGACCTTCGAGAAGCTGATCAGATTGGCCCGTGCCGTTGCCACCTATTCGAAC
CAGGCGATCGATGACCAGCGTCCCATCCTCTCCGCCACCTTGCCCGACGAGGAGCGCATCCAGATCGTCA
TTCCGCCTGCCACCAGCAAAGGTACCGTCAGCATAACCATTCGCAAACCGGCTTCTGTGGCGGTCAGCCT
CGAGGATCTCGAGAGGCAGGGACTATTTTCGCAGACGACGCCCGGAGGCGACGAACTCCAGTCATCGGAT
CACGGGCTCCTTGAGCTTCACAAGGCCGGAGCCTACACGGAATTTCTGCGCAAGGCGGTTCTTGCACGCA
AGAACATCATAATTTCCGGGGCAACGGGGTCGGGCAAAACGACACTTTCCAAGGCCCTCATCCGGTATAT
CCCTGACCACGAGCGCATCCTCTCGATCGAGGACACGCCGGAGCTCGTAATTCCGCAGCCAAATCACGTC
AGGTTGTTCTATTCAAAAGACGGACAGGGGGTCGCGAAAATCGGCGCGAAAGAACTCCTGGAGTCCTGCC
TGCGGATGCGCCCGGATCGCATTCTCCTGCAGGAACTGCGCGATGGAACGGCCTTCTATTTCATCCGCAA
CGTCAACTCCGGGCACCCGGGATCGATCACGACGGTGCATGCCGATTCCACCAAGCTGGCGTTCGAACAG
CTGACGCTTCTCGTAAAGGAATCCGACGGCGGCAAGGACCTGGAGCGGCAAGATATCATGAGCCTCCTGA
GAATTGCGATCGACGTCGTCGTTCAATGCAAGCGGATCCACGGGCGGTTCCACGTGACCGAGATCTACTT
CGATGCGAAGTGCTGA
 Primer design