SecReT4
Protein ID: 227819287
T4SS name [ID]VirB [224]
Gene symboltraG
Locus tagNGR_b10520
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234b [GenBank: NC_012586] [Browse all T4SS(s) in this replicon]
Location [Strand]1011201..1013114 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDC3KQZ7
KEGG IDrhi:NGR_b10520
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.8e-91, Aligned region: 166..631
TraG-D_C [PF12696], Evalue: 2.3e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 1.8e-21, Aligned region: 392..612
Protein Sequence: 637 a.a.     [Download]
>gi|227819287|ref|YP_002823258.1| conjugal transfer coupling protein TraG [Sinorhizobium fredii NGR234]
MAVKGKRHPNLLLILVPVTVTAFAAYVVGWRWQELAAGMSGKTAYWFLRAAPVPALLFGPLAGLVSVWAL
PLYRRRPVAIASLACFLVVVGFYALREYGRLVPSVESGAVTWDRALSYLDLLVVVGAVIGFLAVAVSARI
SVVVPEPVRRARRGTFGDADWLPMSAAARLFPEDGEIVVGERYRVDKQIIHELPFDPNDRSTWGQGGKAA
LLTYKQDFDSTHMLFFAGSGGYKTTSNVVPTALRYTGPLICLDPSTEVAPMVVEHRTCALGREVMVLDPT
NPIIGFNVLDGIENSTHKEEEIVGIAHMLLSESARFESSSGAYFQNQAHNLLTGLLAHVMLSPEYAGRRH
LRSLRQIVSEPEPSVLAMLRDIQEHSASAFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALAC
GNAFKSTDIVTGNKDVFLNIPASILRSYPGIGRVIIGSLINAMIGADGRFKRRALFMLDEVDLLGYMRVL
EEARDRGRKYGLTMMLMYQSLGQLERHFGKDGATSWIESCAFASYAAVKALDTARNVSAQCGEMTVEVRS
QSRNVSWDTKAGGSRKSESVNYQRRPLIMAHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRNEMNRAAK
PSRFVKY
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|227818258|ref|NC_012586.1|:c1013114-1011201 Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence
TTGGCAGTGAAGGGCAAACGGCATCCAAATCTGCTCCTCATTCTTGTGCCGGTCACAGTTACCGCCTTTG
CCGCTTATGTTGTCGGCTGGCGGTGGCAGGAATTGGCGGCGGGGATGTCAGGCAAGACGGCATACTGGTT
CTTGCGGGCAGCACCCGTGCCGGCGCTTCTATTCGGACCACTGGCGGGACTTGTGTCTGTGTGGGCGCTG
CCACTATACCGGCGTAGACCGGTCGCGATAGCGAGCCTCGCGTGCTTTCTGGTGGTCGTCGGTTTCTATG
CTTTGCGTGAATACGGTCGCCTCGTCCCGTCCGTCGAGAGTGGAGCGGTCACATGGGACCGCGCACTCTC
CTACCTAGACCTGCTTGTCGTCGTCGGCGCGGTCATCGGCTTCCTGGCGGTAGCCGTCTCCGCCCGCATT
TCTGTCGTCGTGCCAGAACCGGTCAGGCGCGCCAGGCGCGGAACCTTCGGCGACGCCGACTGGCTGCCGA
TGTCGGCAGCGGCGAGGCTGTTCCCGGAGGACGGCGAGATCGTCGTCGGCGAGCGCTACCGCGTCGACAA
GCAAATCATCCATGAGCTGCCCTTCGATCCGAATGATCGCAGTACTTGGGGACAGGGCGGCAAAGCTGCT
TTGCTCACCTACAAGCAGGACTTCGATTCGACCCATATGCTGTTCTTTGCCGGGTCTGGTGGATACAAGA
CGACCAGTAACGTGGTGCCAACGGCGCTTCGCTACACCGGCCCGCTGATCTGCCTCGATCCCTCGACAGA
AGTCGCTCCCATGGTCGTCGAGCATCGCACCTGCGCACTTGGTCGCGAGGTGATGGTGCTGGATCCGACG
AACCCGATCATAGGCTTTAACGTGCTCGATGGAATTGAGAATTCAACACATAAGGAGGAAGAAATCGTCG
GCATCGCTCACATGCTGCTGTCAGAGAGCGCACGTTTCGAATCCTCGAGCGGCGCCTATTTCCAGAACCA
GGCGCATAATCTCCTCACCGGCCTCCTGGCGCACGTCATGCTCTCACCGGAATATGCCGGACGGCGCCAC
CTTCGCAGTCTTCGGCAGATCGTATCCGAGCCTGAGCCTTCCGTGCTTGCCATGCTGCGCGACATTCAGG
AGCATTCGGCATCCGCCTTCATACGCGAAACGCTCGGCGTCTTCACCAACATGACCGAGCAGACGTTCAG
CGGCGTCTATTCGACCGCTTCGAAGGATACGCAGTGGTTGTCGCTCGACAGCTATGCCGCGCTCGCCTGC
GGAAATGCTTTCAAATCGACTGATATCGTAACCGGCAATAAGGACGTGTTTCTGAACATTCCCGCATCCA
TCCTGCGCTCCTACCCGGGGATTGGTCGCGTCATCATCGGCTCGCTGATCAATGCGATGATCGGGGCCGA
TGGCCGCTTCAAGCGCCGGGCGCTCTTCATGCTCGATGAGGTGGATCTTCTTGGCTATATGCGGGTGCTG
GAAGAGGCCCGCGACCGTGGGCGCAAGTACGGCCTCACCATGATGCTTATGTACCAGTCCCTGGGCCAAC
TCGAGCGGCATTTCGGCAAAGATGGCGCGACATCTTGGATCGAAAGCTGCGCGTTCGCGAGTTATGCGGC
GGTCAAGGCACTCGATACTGCTCGTAACGTCTCGGCGCAATGCGGGGAAATGACGGTCGAGGTACGGAGC
CAATCTCGCAACGTCAGTTGGGACACAAAGGCCGGCGGCTCGCGCAAGTCCGAGAGCGTGAACTATCAAC
GCAGACCGCTGATCATGGCACACGAGATCACGCAGTCGATGCGCAAGGACGAGCAGATCATTATCGTGCA
GGGGCATAGCCCGATACGCTGTGGACGGGCGATTTACTTCCGGCGCAATGAGATGAACCGCGCTGCGAAG
CCCAGCCGCTTCGTAAAATATTGA
 Primer design