SecReT4
Protein ID: 229269513
T4SS name [ID]Tra_F [112]
Gene symboltraU
Locus tagKPN_pKPN3p06020
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]153487..154479 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDA6TIH6
KEGG IDkpn:KPN_pKPN3p06020
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.8e-85, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|229269513|ref|YP_001338629.2| conjugal transfer pilus assembly protein TraU [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKTLTLFLSALMLWGYSLSAAADPSCEGRFVNPITDVCWRCIFPLSLGSVQVGKGDLPDTSNPGSPLQLC
PAPPPIFVRPGLAIGYWEPMAMTDVSRSPGCMVNLGGFSINLGKTGMGTARKDDKQVNGAFYHVHWYKYP
LTYWLNIITSAGCLEGGDMDIAYLSEIDPTWVDSSLTTILNPEAILFANPIAQGACAADAMASAFHMPLD
ILFWCAGSQGSMYPFSGWVSNESSPLQSSLLVSERMAYKLHRQGQIMESIGKDKAVCYEYPSPIIPKERW
RYQMVNMYPDSGQCHPVGRSVMRWEAGKNPPNTRKNYGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|152973416|ref|NC_009649.1|:153487-154479 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
GTGAAAACCCTGACGCTTTTCCTGAGTGCCCTGATGTTGTGGGGGTACAGCCTCAGTGCGGCTGCTGATC
CCTCCTGTGAGGGCCGGTTTGTTAACCCGATCACCGATGTGTGCTGGCGCTGCATCTTCCCCCTGTCGCT
CGGCAGCGTGCAGGTTGGTAAAGGCGATCTGCCTGATACCAGCAATCCGGGTAGTCCCCTGCAGCTGTGT
CCGGCGCCGCCACCGATTTTTGTTCGACCCGGCCTGGCCATCGGGTACTGGGAGCCGATGGCCATGACGG
ACGTCAGCCGTTCGCCTGGCTGTATGGTCAATCTGGGGGGCTTCAGTATCAATCTCGGCAAGACCGGCAT
GGGGACCGCGAGAAAGGACGATAAGCAGGTGAACGGCGCCTTCTATCACGTTCACTGGTACAAGTACCCG
CTGACGTACTGGCTGAACATCATCACTTCGGCAGGGTGTCTGGAAGGCGGAGACATGGATATAGCCTATC
TGTCCGAGATTGACCCGACCTGGGTGGACAGCAGCCTCACCACCATTCTGAATCCGGAAGCCATCCTGTT
TGCCAACCCCATCGCACAGGGGGCGTGCGCGGCTGACGCTATGGCCAGCGCGTTTCATATGCCACTCGAT
ATTCTGTTCTGGTGTGCCGGCTCTCAGGGTTCGATGTACCCGTTTAGCGGCTGGGTAAGCAACGAGTCCA
GTCCGCTGCAGTCCTCGTTACTTGTCAGCGAGCGCATGGCGTACAAGCTTCACCGGCAGGGACAAATTAT
GGAGAGCATCGGGAAGGACAAGGCGGTCTGCTATGAGTATCCGTCCCCGATCATCCCCAAAGAGCGCTGG
CGCTATCAGATGGTGAACATGTACCCGGACAGCGGCCAGTGCCATCCCGTGGGGCGCAGCGTGATGCGCT
GGGAGGCCGGTAAAAATCCACCCAACACCCGTAAGAACTATGGCTATCTGATGTGGCGTAAACGCAATTG
TGTCTTTCTCTGA
 Primer design