SecReT4
Protein ID: 229586343
T4SS name [ID]VirB [480]
Gene symbolvirB3
Locus tagRAF_ORF0128
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]132408..132695 [+]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDC3PME1
KEGG IDraf:RAF_ORF0128
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4e-17, Aligned region: 8..90
Protein Sequence: 95 a.a.     [Download]
>gi|229586343|ref|YP_002844844.1| type IV secretion system protein VirB3 [Rickettsia africae ESF-5]
MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGIMILFIAAALHLVAYIICFKEPRFIE
LYLNKMSRTSQCPNKFYYGANSYNI
 
Nucleotide Sequence: 288 bp     [Download]
>gi|229586230|ref|NC_012633.1|:132408-132695 Rickettsia africae ESF-5 chromosome, complete genome
ATGGCAGGAGCATTAGCATCCGATCTTTTATTTGTAGGGTTAACTAGACCGCCGATGATATTTGGAGTAA
GTATTAAGTTTGCTGCATTAAATATGATAATGACGATGATAGTATTTATTTGGAATAACGGCATTATGAT
TTTATTCATTGCAGCTGCTTTGCATTTGGTAGCTTATATTATATGTTTTAAAGAACCGAGATTCATAGAG
CTATATTTAAATAAAATGTCAAGAACTAGCCAATGTCCTAATAAATTTTACTACGGAGCAAATTCGTATA
ATATTTGA
 Primer design