SecReT4
Protein ID: 229586344
T4SS name [ID]VirB [480]
Gene symbolvirB4-1
Locus tagRAF_ORF0129
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]132785..135202 [+]
Producttype IV secretion system ATPase VirB4
Component typeVirB4
UniProt IDC3PME2
KEGG IDraf:RAF_ORF0129
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.4e-70, Aligned region: 194..399
AAA_10 [PF12846], Evalue: 9.8e-36, Aligned region: 452..727
AAA_23 [PF13476], Evalue: 2.1e-05, Aligned region: 444..576
Protein Sequence: 805 a.a.     [Download]
>gi|229586344|ref|YP_002844845.1| type IV secretion system ATPase VirB4 [Rickettsia africae ESF-5]
MKLFRTRAAKELRSKQERPTSHFIPYKCHWDSNTILTKDNSLLQVIKMNGFSFETADDEDLDIKKNIRNA
LLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILY
KPDTGGVAIVEYFLKKLRQKSNKTVWENDMKEMKENLQEMSTRVINTFRSYGARLLGVRQTQSGSYCEIL
EFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEVRSPLGKKYAGMISILEYGPNTSAGIFDGF
LQMPFEFVMTQSFVFVNRTVAIGKMQLQQNRMIQSGDKATSQIAEINTALDMATSGDIAFGEHHLSLLCS
ANNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLG
KIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRG
AEIFIRALNGVYTVIDPGLKCNFNPLQLEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFR
LAKQDRRLSNIIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQKVRVFGFDMTELLKDPVSLA
PVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAAKSRISD
TLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGIDAVVAKVSLDGMDNIISVL
SGRVETVILLDQIREKHGNDPDKWLPIFYAAVKTL
 
Nucleotide Sequence: 2418 bp     [Download]
>gi|229586230|ref|NC_012633.1|:132785-135202 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAATTATTTAGAACTAGAGCCGCTAAAGAATTAAGGTCTAAACAAGAAAGACCCACTTCGCATTTTA
TTCCTTATAAATGTCATTGGGATAGTAATACTATTTTAACGAAAGATAATTCTTTATTACAAGTTATTAA
AATGAATGGATTTTCTTTTGAAACTGCTGATGATGAAGATCTAGACATTAAAAAGAATATCAGAAATGCC
TTACTTAAAAATATGGCCTCGGGAAATATCGTTATGTATTTCCATACTATTAGAAGACGTAAAGCAGTAA
TATTTGACGATACGGAATTTACTTATGATCCTACCGTAAAAGTCCCTAATGATTTTATTACTTATTTAGG
TGCAGAATGGCGTAAGAAACATGCTGGGGCTAGGTCGTTTTTTAATGAATTATATGTTAGTATTTTATAT
AAGCCTGATACTGGCGGTGTTGCTATAGTTGAGTATTTTCTAAAGAAGCTTAGACAGAAATCTAATAAAA
CCGTTTGGGAAAACGACATGAAAGAGATGAAAGAAAATCTTCAAGAAATGTCAACTAGAGTGATTAATAC
ATTCAGAAGTTACGGAGCAAGATTACTTGGAGTTCGTCAAACGCAGTCAGGTAGTTATTGTGAAATTTTA
GAATTCCTTTCATCTTTAATCAATTGTGGCGATTCACCGGGTCCTATAGCATTACCGCGTGGTACTATTG
ACGAGTATTTACCGACTCATCGCTTATTTTTTGATTCTCGTACTATTGAAGTAAGAAGTCCGCTTGGCAA
GAAATATGCTGGAATGATTAGTATACTTGAATACGGTCCTAATACTTCGGCAGGAATTTTTGACGGATTC
CTGCAAATGCCTTTTGAATTTGTTATGACGCAAAGCTTTGTCTTTGTTAATAGAACAGTAGCGATCGGTA
AAATGCAATTACAGCAAAATAGAATGATACAATCCGGTGATAAAGCTACTTCACAAATTGCTGAAATTAA
TACGGCCCTTGATATGGCCACCAGCGGTGATATCGCTTTCGGTGAGCATCATTTATCGCTTTTATGTTCC
GCAAATAATATTAAAGCTTTGGAAGATATATTGTCAATGGCAGCAGTTGAGCTTTCTAATTCAGGAATTC
AGCCGGTTAGAGAAAAAGTTAACATGGAACCTAGCTATTGGGGACAGTTGCCGGGAAATATGGATTATAT
AGTGCGTAAATCCACTATAAATACTCTTAATATGGCTAGCTTTGCCTCACAACATAATTATCCGCTCGGT
AAAATTAGAGATAACCATTGGGGAGAATATGTCACAGTACTTGATACTACTTCAGGTACACCGTTTTATT
TTAATTTCCATGTAAGGGATGTTGGACATACTCTCATTATCGGTCCAACCGGTGCTGGTAAAACAGTTCT
TATGAATTTCTTATGTGCTGAAGCACAAAAATTCAAACCTCGTATGTTCTTTTTTGATAAAGATCGAGGA
GCAGAAATATTTATACGTGCTTTAAACGGAGTTTATACAGTAATTGATCCGGGTTTAAAATGCAACTTTA
ACCCTTTACAGCTTGAAGATACTAGTGAGAATAGAACGTTTATTTTAGAGTGGCTTCGTGTGCTTGTAAC
TTCTAACGGTGAAAGTTTAACTGCACAAGATAATAAAATCTTATCTCAAGCGGTAAGCGGTAATTTTAGA
TTAGCAAAACAAGATAGAAGGCTTAGTAATATTATAGCATTTCTTGGTATTGATACACCAAATAGTTTGG
CAAGTAGGATTGCAATGTGGGTTGGTAAAGGTTCACACGCTAAGATATTTGACAATGAAATAGATGATAT
TGATTTACAAAAAGTAAGAGTATTCGGTTTTGATATGACTGAATTACTTAAAGATCCTGTAAGTCTTGCA
CCGGTATTACTATATATTTTCCATCGTATTAATATCTCTTTAGATGGGCAGAAAACTATGATAGTACTTG
ATGAAGCATGGGCTTTAATCGATAATCCGGTATTTGCACCTAAGATCAAAGATTGGTTAAAAGTGTTGAG
AAAATTAAATACTTTTGTTATATTTGCTACGCAGAGTGTTGAAGATGCTGCAAAAAGTAGAATTAGTGAT
ACGTTGATTCAACAAACAGCTACGCAGATTTTTTTACCTAATTTGAAAGCTACGGATATTTATCGTAGTG
CATTTATGTTAAGTCAACGAGAATATATTTTAATTAAAACTACCGACCCTACTACACGTTATTTTTTAAT
AAAACAAGGAATAGATGCCGTAGTGGCAAAAGTTAGCTTAGATGGTATGGATAACATAATCAGTGTTTTA
TCCGGTAGAGTTGAGACTGTAATATTGCTCGATCAAATTAGAGAGAAACATGGCAATGATCCGGATAAAT
GGTTACCTATATTTTATGCAGCAGTTAAAACATTATAA
 Primer design