SecReT4
Protein ID: 229586345
T4SS name [ID]VirB [480]
Gene symbolvirB6-1
Locus tagRAF_ORF0130
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]135320..138439 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME3
KEGG IDraf:RAF_ORF0130
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-12, Aligned region: 504..579
Protein Sequence: 1039 a.a.     [Download]
>gi|229586345|ref|YP_002844846.1| VirB6 [Rickettsia africae ESF-5]
MKLFPRSILITLVLSFALNLGIVTKTHAKDTLDSIVDILSGLTCETQGVGDLLRTEFSHTCIVAPFFTFA
VMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFPGGQCTRENRIDPKNPELRFALCNNAKLIVSRAKSVA
ESALAIAKAVLTGSDPWDDIKTAWANKKKEYHVPYSGKPGDDGFAFDLGFPVIYWKVIQDKDRICVSTKG
FTGDVPVGCKYMKEPFPKSMYNSFMDVADKDFIEDPNKTPTDPLALVSCSAAGDGCYQKAYNASKTAVVM
TSPLIECMRQMIARLLISKDVCSLDNVSQVVNLVSRQDSVFFQFQVGMYKIVTAFLTLYVMFFGFKLLLA
GEVPPKSEYINFILKMIFVTYFSIGINITPGNGSPYDRLDGMIQWAFPFLLDGINGLASWVMNAAPSGLC
KFNNLSYDGTVSYIALWDALDCRVAHYLGLDILSTLLVENAYRSHDFLNFDFFSFSAPPYIYLLIPAIIS
GNMMLVSLALSYPLLVISVAAFMVNATIMCMISIVILGILAPLFVPMFLFAYTRNYFESWVKLMISFLLQ
PMVVVTFMITMFSVYDYGFYGKCQYKSKLIHNSIEDKIQGGITSKRDVLIFYINNDWDDTSQYPDKDAVE
SCQNSLGYMLNNPITTVFNFTKDSVSEIVDSKPGSTPTDKFLAKFQFLSGVVLGPGMFFMSPKVLFEKIK
NILLALVMACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMAVLATAGAATKGGDQIASR
GGVGDLKAGQGGGASDLEVGKGGLPNDNIAASGGTSAPAVTTPTASSSVATSSPKTVSSEARSDVVTPPA
PTEAVSPPSASIRTSISTPTASSSVATSSPKTVSSEARSDVVIPPAPTEAVSPPSASIRTSISTPAPRVG
KIIRDNNQESKKEIDNTPPSQEKVDNAAPQEKVDSTSKGTGVIDYSFNLKEHDNPTGVKQIRENAEIRDK
RVKVEKVWNELVASGGGRVREQEGGEISERRANAEKAWDELVKSGVVTEKKDNSSNENS
 
Nucleotide Sequence: 3120 bp     [Download]
>gi|229586230|ref|NC_012633.1|:135320-138439 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAATTATTTCCTCGTAGTATACTTATAACATTAGTATTAAGCTTTGCCCTAAATTTAGGGATAGTTA
CTAAAACTCATGCTAAAGATACTCTTGATAGCATTGTAGATATTTTGAGTGGCTTAACTTGCGAAACCCA
AGGCGTAGGCGATTTGCTGCGTACTGAATTTTCTCATACATGTATTGTTGCTCCGTTCTTTACTTTTGCG
GTAATGAATCTTGTCTCTCCCGTTTTATACATGAATACGTTTTTAAAGCTTAAAATAAACGACAGTGATT
TATTTAACGATAGTAACTTTGGGAATTTTCCCGGAGGTCAATGTACTCGTGAAAACAGAATTGATCCTAA
AAATCCAGAATTACGCTTTGCTTTATGTAATAATGCTAAATTAATTGTATCTCGGGCAAAATCTGTTGCA
GAATCGGCACTTGCTATTGCTAAAGCCGTCTTAACAGGGAGCGACCCTTGGGATGATATAAAGACAGCGT
GGGCAAATAAAAAAAAGGAATATCATGTTCCATATAGTGGTAAGCCCGGTGATGACGGTTTTGCATTTGA
TTTAGGTTTTCCTGTAATATATTGGAAAGTTATTCAAGATAAAGATAGAATATGCGTATCGACAAAAGGA
TTTACAGGAGACGTTCCCGTTGGCTGTAAATATATGAAAGAGCCGTTTCCAAAATCCATGTATAATAGCT
TTATGGATGTAGCAGATAAGGATTTTATTGAGGATCCAAATAAAACTCCTACCGATCCTTTAGCTTTAGT
TTCCTGTAGTGCAGCGGGTGATGGATGTTATCAAAAAGCTTATAATGCTTCAAAAACTGCAGTAGTCATG
ACTTCTCCTCTTATAGAATGTATGAGGCAAATGATTGCTAGATTACTAATTAGTAAAGATGTTTGTAGTT
TGGATAATGTAAGCCAAGTGGTTAATTTGGTTTCAAGGCAAGATAGTGTATTCTTTCAGTTTCAAGTAGG
AATGTATAAAATAGTTACGGCTTTTCTAACTTTATATGTTATGTTTTTTGGCTTTAAACTATTACTTGCA
GGTGAAGTGCCGCCAAAAAGTGAGTATATAAATTTTATATTGAAAATGATATTCGTAACTTATTTTTCAA
TAGGAATTAATATAACCCCTGGTAATGGTTCTCCGTATGACCGGTTAGACGGCATGATTCAGTGGGCGTT
TCCTTTCTTACTTGACGGTATAAACGGTTTAGCAAGTTGGGTTATGAATGCTGCTCCGTCCGGTTTATGT
AAATTTAACAATCTTTCTTATGACGGTACCGTTTCTTATATTGCATTATGGGATGCATTAGATTGTAGGG
TAGCTCATTATTTAGGGCTTGATATATTATCTACGTTACTTGTCGAAAATGCTTATCGCAGTCATGATTT
TTTAAATTTTGATTTCTTTAGTTTTAGTGCTCCACCATATATTTATTTGCTAATTCCGGCGATAATCTCC
GGTAATATGATGTTGGTGTCACTCGCTCTTTCTTATCCGTTACTTGTGATTTCGGTTGCTGCCTTTATGG
TTAATGCAACGATTATGTGTATGATATCTATAGTAATACTCGGTATTTTGGCTCCTCTTTTTGTACCTAT
GTTTTTATTCGCATATACAAGAAATTATTTTGAGAGCTGGGTTAAACTAATGATCTCGTTCTTGCTACAA
CCTATGGTGGTAGTTACTTTTATGATCACGATGTTTTCGGTATATGATTATGGTTTCTACGGTAAATGTC
AATATAAGAGCAAGTTAATTCACAATAGTATAGAAGACAAAATTCAAGGTGGCATTACTTCTAAGAGGGA
TGTTTTAATATTTTACATTAATAATGATTGGGATGATACGTCACAGTATCCTGATAAAGATGCTGTAGAA
AGTTGTCAAAATAGTTTAGGTTATATGTTAAATAACCCTATTACCACAGTATTTAACTTTACAAAAGATA
GTGTAAGTGAAATTGTCGATAGTAAACCGGGTAGTACCCCTACCGATAAATTTCTTGCTAAATTCCAGTT
TTTATCGGGAGTAGTTTTAGGGCCCGGAATGTTTTTCATGTCTCCAAAAGTGCTTTTTGAGAAAATTAAA
AATATTTTGCTTGCGTTAGTTATGGCATGTTTTACATTGTATTTGATGTATAATTTTAGTAGTCAGCTAG
CTGAATTTGCTGCAGATATGACGGAAGGAGTAGCTCTTAATAATGTTGCTATAAAACCGCAAGCAATATT
TAAGGCAGCTATGGCAGTACTTGCTACTGCGGGTGCTGCAACTAAGGGGGGCGATCAGATAGCAAGTAGA
GGAGGAGTTGGTGATTTAAAAGCTGGTCAAGGTGGAGGAGCAAGTGATTTAGAGGTAGGGAAAGGCGGAC
TACCAAATGATAATATTGCTGCAAGCGGAGGTACGTCGGCACCTGCGGTAACAACGCCGACAGCTTCGTC
TTCTGTAGCAACTTCTAGCCCAAAAACTGTAAGTAGTGAAGCAAGATCAGATGTTGTTACTCCTCCTGCT
CCTACAGAAGCTGTTTCACCACCGTCTGCTAGTATTAGAACTTCTATTTCTACGCCGACAGCTTCGTCTT
CTGTAGCAACTTCTAGCCCAAAAACTGTAAGTAGTGAAGCAAGATCAGATGTTGTTATTCCTCCTGCTCC
TACAGAAGCTGTTTCACCACCGTCTGCTAGTATTAGAACTTCTATTTCTACACCTGCACCACGTGTTGGA
AAAATCATAAGAGATAATAATCAAGAAAGTAAAAAAGAGATTGATAATACTCCGCCTTCACAGGAAAAAG
TTGATAATGCAGCTCCACAAGAAAAAGTTGACAGCACAAGTAAAGGTACAGGAGTAATTGATTATAGTTT
TAACTTAAAGGAACATGATAATCCGACAGGCGTAAAACAGATACGGGAAAATGCAGAGATTCGAGATAAA
CGTGTAAAAGTAGAAAAAGTATGGAATGAACTAGTAGCAAGTGGAGGAGGAAGAGTAAGAGAACAAGAAG
GAGGAGAAATATCAGAACGACGTGCAAATGCTGAAAAGGCATGGGATGAGTTAGTAAAAAGCGGCGTAGT
AACAGAAAAAAAAGATAATAGTTCTAATGAAAACTCTTAA
 Primer design