SecReT4
Protein ID: 229586345
T4SS name [ID]VirB [480]
Gene symbolvirB6-1
Locus tagRAF_ORF0130
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]135320..138439 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME3
KEGG IDraf:RAF_ORF0130
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-12, Aligned region: 504..579
Protein Sequence: 1039 a.a.     [Download]
>gi|229586345|ref|YP_002844846.1| VirB6 [Rickettsia africae ESF-5]
MKLFPRSILITLVLSFALNLGIVTKTHAKDTLDSIVDILSGLTCETQGVGDLLRTEFSHTCIVAPFFTFA
VMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFPGGQCTRENRIDPKNPELRFALCNNAKLIVSRAKSVA
ESALAIAKAVLTGSDPWDDIKTAWANKKKEYHVPYSGKPGDDGFAFDLGFPVIYWKVIQDKDRICVSTKG
FTGDVPVGCKYMKEPFPKSMYNSFMDVADKDFIEDPNKTPTDPLALVSCSAAGDGCYQKAYNASKTAVVM
TSPLIECMRQMIARLLISKDVCSLDNVSQVVNLVSRQDSVFFQFQVGMYKIVTAFLTLYVMFFGFKLLLA
GEVPPKSEYINFILKMIFVTYFSIGINITPGNGSPYDRLDGMIQWAFPFLLDGINGLASWVMNAAPSGLC
KFNNLSYDGTVSYIALWDALDCRVAHYLGLDILSTLLVENAYRSHDFLNFDFFSFSAPPYIYLLIPAIIS
GNMMLVSLALSYPLLVISVAAFMVNATIMCMISIVILGILAPLFVPMFLFAYTRNYFESWVKLMISFLLQ
PMVVVTFMITMFSVYDYGFYGKCQYKSKLIHNSIEDKIQGGITSKRDVLIFYINNDWDDTSQYPDKDAVE
SCQNSLGYMLNNPITTVFNFTKDSVSEIVDSKPGSTPTDKFLAKFQFLSGVVLGPGMFFMSPKVLFEKIK
NILLALVMACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMAVLATAGAATKGGDQIASR
GGVGDLKAGQGGGASDLEVGKGGLPNDNIAASGGTSAPAVTTPTASSSVATSSPKTVSSEARSDVVTPPA
PTEAVSPPSASIRTSISTPTASSSVATSSPKTVSSEARSDVVIPPAPTEAVSPPSASIRTSISTPAPRVG
KIIRDNNQESKKEIDNTPPSQEKVDNAAPQEKVDSTSKGTGVIDYSFNLKEHDNPTGVKQIRENAEIRDK
RVKVEKVWNELVASGGGRVREQEGGEISERRANAEKAWDELVKSGVVTEKKDNSSNENS
 
Nucleotide Sequence: 3120 bp     [Download]
>gi|229586230|ref|NC_012633.1|:135320-138439 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAATTATTTCCTCGTAGTATACTTATAACATTAGTATTAAGCTTTGCCCTAAATTTAGGGATAGTTA
CTAAAACTCATGCTAAAGATACTCTTGATAGCATTGTAGATATTTTGAGTGGCTTAACTTGCGAAACCCA
AGGCGTAGGCGATTTGCTGCGTACTGAATTTTCTCATACATGTATTGTTGCTCCGTTCTTTACTTTTGCG
GTAATGAATCTTGTCTCTCCCGTTTTATACATGAATACGTTTTTAAAGCTTAAAATAAACGACAGTGATT
TATTTAACGATAGTAACTTTGGGAATTTTCCCGGAGGTCAATGTACTCGTGAAAACAGAATTGATCCTAA
AAATCCAGAATTACGCTTTGCTTTATGTAATAATGCTAAATTAATTGTATCTCGGGCAAAATCTGTTGCA
GAATCGGCACTTGCTATTGCTAAAGCCGTCTTAACAGGGAGCGACCCTTGGGATGATATAAAGACAGCGT
GGGCAAATAAAAAAAAGGAATATCATGTTCCATATAGTGGTAAGCCCGGTGATGACGGTTTTGCATTTGA
TTTAGGTTTTCCTGTAATATATTGGAAAGTTATTCAAGATAAAGATAGAATATGCGTATCGACAAAAGGA
TTTACAGGAGACGTTCCCGTTGGCTGTAAATATATGAAAGAGCCGTTTCCAAAATCCATGTATAATAGCT
TTATGGATGTAGCAGATAAGGATTTTATTGAGGATCCAAATAAAACTCCTACCGATCCTTTAGCTTTAGT
TTCCTGTAGTGCAGCGGGTGATGGATGTTATCAAAAAGCTTATAATGCTTCAAAAACTGCAGTAGTCATG
ACTTCTCCTCTTATAGAATGTATGAGGCAAATGATTGCTAGATTACTAATTAGTAAAGATGTTTGTAGTT
TGGATAATGTAAGCCAAGTGGTTAATTTGGTTTCAAGGCAAGATAGTGTATTCTTTCAGTTTCAAGTAGG
AATGTATAAAATAGTTACGGCTTTTCTAACTTTATATGTTATGTTTTTTGGCTTTAAACTATTACTTGCA
GGTGAAGTGCCGCCAAAAAGTGAGTATATAAATTTTATATTGAAAATGATATTCGTAACTTATTTTTCAA
TAGGAATTAATATAACCCCTGGTAATGGTTCTCCGTATGACCGGTTAGACGGCATGATTCAGTGGGCGTT
TCCTTTCTTACTTGACGGTATAAACGGTTTAGCAAGTTGGGTTATGAATGCTGCTCCGTCCGGTTTATGT
AAATTTAACAATCTTTCTTATGACGGTACCGTTTCTTATATTGCATTATGGGATGCATTAGATTGTAGGG
TAGCTCATTATTTAGGGCTTGATATATTATCTACGTTACTTGTCGAAAATGCTTATCGCAGTCATGATTT
TTTAAATTTTGATTTCTTTAGTTTTAGTGCTCCACCATATATTTATTTGCTAATTCCGGCGATAATCTCC
GGTAATATGATGTTGGTGTCACTCGCTCTTTCTTATCCGTTACTTGTGATTTCGGTTGCTGCCTTTATGG
TTAATGCAACGATTATGTGTATGATATCTATAGTAATACTCGGTATTTTGGCTCCTCTTTTTGTACCTAT
GTTTTTATTCGCATATACAAGAAATTATTTTGAGAGCTGGGTTAAACTAATGATCTCGTTCTTGCTACAA
CCTATGGTGGTAGTTACTTTTATGATCACGATGTTTTCGGTATATGATTATGGTTTCTACGGTAAATGTC
AATATAAGAGCAAGTTAATTCACAATAGTATAGAAGACAAAATTCAAGGTGGCATTACTTCTAAGAGGGA
TGTTTTAATATTTTACATTAATAATGATTGGGATGATACGTCACAGTATCCTGATAAAGATGCTGTAGAA
AGTTGTCAAAATAGTTTAGGTTATATGTTAAATAACCCTATTACCACAGTATTTAACTTTACAAAAGATA
GTGTAAGTGAAATTGTCGATAGTAAACCGGGTAGTACCCCTACCGATAAATTTCTTGCTAAATTCCAGTT
TTTATCGGGAGTAGTTTTAGGGCCCGGAATGTTTTTCATGTCTCCAAAAGTGCTTTTTGAGAAAATTAAA
AATATTTTGCTTGCGTTAGTTATGGCATGTTTTACATTGTATTTGATGTATAATTTTAGTAGTCAGCTAG
CTGAATTTGCTGCAGATATGACGGAAGGAGTAGCTCTTAATAATGTTGCTATAAAACCGCAAGCAATATT
TAAGGCAGCTATGGCAGTACTTGCTACTGCGGGTGCTGCAACTAAGGGGGGCGATCAGATAGCAAGTAGA
GGAGGAGTTGGTGATTTAAAAGCTGGTCAAGGTGGAGGAGCAAGTGATTTAGAGGTAGGGAAAGGCGGAC
TACCAAATGATAATATTGCTGCAAGCGGAGGTACGTCGGCACCTGCGGTAACAACGCCGACAGCTTCGTC
TTCTGTAGCAACTTCTAGCCCAAAAACTGTAAGTAGTGAAGCAAGATCAGATGTTGTTACTCCTCCTGCT
CCTACAGAAGCTGTTTCACCACCGTCTGCTAGTATTAGAACTTCTATTTCTACGCCGACAGCTTCGTCTT
CTGTAGCAACTTCTAGCCCAAAAACTGTAAGTAGTGAAGCAAGATCAGATGTTGTTATTCCTCCTGCTCC
TACAGAAGCTGTTTCACCACCGTCTGCTAGTATTAGAACTTCTATTTCTACACCTGCACCACGTGTTGGA
AAAATCATAAGAGATAATAATCAAGAAAGTAAAAAAGAGATTGATAATACTCCGCCTTCACAGGAAAAAG
TTGATAATGCAGCTCCACAAGAAAAAGTTGACAGCACAAGTAAAGGTACAGGAGTAATTGATTATAGTTT
TAACTTAAAGGAACATGATAATCCGACAGGCGTAAAACAGATACGGGAAAATGCAGAGATTCGAGATAAA
CGTGTAAAAGTAGAAAAAGTATGGAATGAACTAGTAGCAAGTGGAGGAGGAAGAGTAAGAGAACAAGAAG
GAGGAGAAATATCAGAACGACGTGCAAATGCTGAAAAGGCATGGGATGAGTTAGTAAAAAGCGGCGTAGT
AACAGAAAAAAAAGATAATAGTTCTAATGAAAACTCTTAA
 Primer design

Protein ID: 229586346
T4SS name [ID]VirB [480]
Gene symbolvirB6-3
Locus tagRAF_ORF0133
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]140419..143319 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME4
KEGG IDraf:RAF_ORF0133
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-31, Aligned region: 605..844
Protein Sequence: 966 a.a.     [Download]
>gi|229586346|ref|YP_002844847.1| VirB6 [Rickettsia africae ESF-5]
MQGNLLKVLGVLAIVATLVCFIFAALGMIGAVKVGDSCYMRYASDGQGGADSITGTITLNANANYVNTTK
MLSDGTTLLVPDPTRYGEWLNTQVLVENSQPVNLQVVGQVSLCLAYIPKDNLQRTGAGSNLDDNGQMIPI
PRINDTNNPPVSLIMDAKNNEWRNIAELYANDRVLVSVSPNFANTDATVKDAFKGAEVTQDCSENKTTYN
PICGKYSVYSGKYVNACELKEKYWNCQVTWRCPNWYEQAGCDWGALGCIASCQKIPECTTKCMAWVNIMR
PAPENYLDDESFTFSWSDNTGKLFIDYSALQCSYNANIPPADQCPDRVHDRRTKDKDYIGGVHCTSGICS
DGDFQKNRRFWYTADGKGGKGPTGLIYQMNDAGSVSQALPSKLEFAKFVADTDQPPDYKDKDGKYLYKVI
YNIPFNSDIAKSYLQYRLWSPTSQDSSKNTGGYVLNIKQTKCYRENGNSFNDTFDDRGRVQYIIVKPSEN
PNTSGKTYSPQGISVDSEGKYSFNANEAGYIWMKILNDPGNNLRDYKDSEGSYKVHFSTSLKVGSFSIKV
MNPLLQLFKTKVQGAATSIFKNMVCYKANDSSSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQKELVI
RIAKIGVVSGLMNGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDAVMSKIFFSQT
FIAQLLALLSLGLSGIIYFIITFIAVCIVIITALRAVAVYIMAFMATCILIGIAPLFISFLLFDFTRYLF
DNWVRFTIRYMLEPVVMMAGIIVLTQLFTIYLDFVLGYSVCWKCALPIKIPFIGTILPIALLNVPIFCIN
WFAPWGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGRMVVKLTSAVGPSATEIGGKMSHDAGQKALS
SIGMDDKTRQGITGRAEARLKQRNKTLDQAEKNRKNTPKEGGEKTNEEPPKPETPK
 
Nucleotide Sequence: 2901 bp     [Download]
>gi|229586230|ref|NC_012633.1|:140419-143319 Rickettsia africae ESF-5 chromosome, complete genome
ATGCAGGGTAACTTATTAAAAGTTTTAGGAGTACTTGCTATAGTAGCAACGTTAGTTTGCTTTATTTTTG
CAGCACTTGGTATGATAGGAGCAGTAAAAGTCGGTGACAGCTGCTACATGAGATATGCATCGGACGGTCA
AGGAGGAGCGGATTCAATAACCGGTACTATAACCCTTAATGCTAATGCTAATTATGTAAACACTACTAAG
ATGTTGTCCGACGGCACGACTCTGCTTGTTCCTGATCCTACTCGTTACGGTGAATGGCTAAATACTCAGG
TGCTAGTAGAAAACAGCCAACCGGTGAATTTACAAGTGGTCGGTCAGGTTAGTTTGTGTTTAGCTTATAT
ACCGAAAGATAATTTACAACGTACAGGGGCTGGATCTAATTTAGACGATAACGGTCAAATGATCCCGATT
CCTCGTATTAACGATACAAATAATCCACCTGTCTCTCTAATAATGGATGCAAAAAATAATGAATGGCGTA
ATATTGCCGAATTATACGCCAATGATAGAGTTTTAGTTTCCGTATCTCCTAATTTTGCCAATACGGATGC
GACAGTTAAAGATGCTTTTAAAGGTGCTGAAGTTACGCAAGATTGTTCAGAGAATAAAACTACTTATAAT
CCAATTTGTGGAAAATATTCTGTTTATTCAGGTAAGTATGTCAATGCTTGCGAGTTAAAAGAGAAATATT
GGAATTGTCAAGTCACATGGAGGTGCCCTAACTGGTATGAGCAAGCAGGTTGCGACTGGGGAGCATTGGG
CTGTATTGCGTCTTGTCAAAAGATACCAGAATGTACAACGAAATGTATGGCTTGGGTTAATATAATGAGA
CCAGCACCAGAAAACTACCTAGATGATGAGAGTTTTACATTTTCGTGGTCTGACAACACAGGTAAATTAT
TTATCGACTATTCAGCCCTTCAATGTTCTTATAATGCTAATATTCCTCCAGCTGATCAATGTCCTGATCG
TGTTCACGATCGTCGTACAAAAGATAAAGATTATATTGGAGGTGTACATTGTACTTCGGGCATATGTAGC
GATGGAGATTTTCAAAAGAATCGGAGATTTTGGTATACGGCGGACGGTAAAGGAGGCAAAGGACCAACTG
GATTAATATATCAAATGAATGATGCGGGTTCTGTAAGTCAAGCTCTGCCTTCTAAGCTAGAATTTGCTAA
ATTTGTTGCAGATACAGATCAACCGCCTGACTATAAAGATAAAGACGGTAAATATTTATATAAAGTTATA
TATAATATACCTTTTAACAGTGATATTGCAAAAAGTTATTTACAATATAGGCTGTGGTCGCCTACCTCAC
AAGATAGTAGTAAGAATACGGGAGGATACGTTTTAAATATTAAACAGACTAAATGCTATAGAGAAAACGG
TAATAGTTTTAACGATACTTTTGATGATCGAGGACGAGTGCAATACATCATAGTAAAGCCTTCGGAAAAC
CCGAATACTAGCGGTAAAACCTATTCACCTCAAGGAATTAGCGTTGATAGTGAAGGTAAATATAGCTTTA
ACGCAAATGAGGCGGGTTATATATGGATGAAAATTCTAAATGATCCTGGTAATAATTTAAGGGACTATAA
AGATAGTGAAGGTAGCTATAAAGTACATTTCTCAACATCCTTAAAAGTAGGAAGTTTTTCTATTAAAGTA
ATGAATCCGTTACTTCAGTTATTTAAAACTAAAGTGCAAGGGGCTGCTACTTCTATTTTTAAAAATATGG
TATGTTATAAAGCTAATGATAGTTCGTCCTGTACTAACTTTTTTACCTATATTAAAGCAATTTTAATTCT
GTATGTGATGACTTACGGAGCAATGTTTTTACTTGGTTTTGCTAAGATAAACCAAAAAGAGCTAGTAATT
AGAATAGCAAAAATCGGGGTAGTTAGCGGACTGATGAACGGTAATACCTTTGAATTTTTCAATAACTATC
TTTTTGATGCAATTACCAATTTTTCAGACTCAATTATTGCTAATATGAGTGGATATAGTTTGTTTACTTC
TACTAATACTATTTCTAATCCTTTCATGTTTTTAGATGCAGTAATGAGTAAAATATTTTTTAGTCAAACC
TTTATCGCTCAATTACTTGCACTTCTTTCTCTTGGGCTTAGCGGTATTATATATTTTATAATTACTTTTA
TTGCGGTTTGTATAGTAATTATTACGGCGCTTAGAGCTGTTGCCGTTTATATTATGGCATTTATGGCAAC
TTGTATATTAATCGGTATAGCCCCTTTATTTATTAGTTTCTTATTATTTGATTTTACTAGGTATTTATTT
GATAATTGGGTGAGGTTTACGATCCGCTATATGCTGGAACCGGTAGTTATGATGGCAGGTATTATAGTGC
TAACACAACTATTTACCATTTATCTAGATTTTGTTTTAGGTTATAGCGTGTGTTGGAAATGTGCTTTACC
GATAAAAATTCCGTTTATCGGTACTATTTTACCTATTGCCTTGCTGAATGTACCTATCTTCTGTATTAAT
TGGTTTGCCCCTTGGGGAATGGATTATATGTCGGGTATGATGGGAGTAAATATGCAAAATATCGTAGCTC
TAGTTATTATTGCTTACGGTATGTACGGTTATGTCGAATTTTCAGGACGTATGGTAGTAAAATTAACTAG
TGCTGTTGGGCCTTCGGCTACTGAAATTGGTGGTAAAATGTCTCATGATGCAGGACAAAAAGCATTAAGT
TCAATAGGAATGGATGATAAAACAAGACAAGGTATTACCGGCAGAGCGGAAGCACGATTAAAACAACGCA
ATAAGACATTAGATCAGGCTGAGAAAAATAGGAAAAATACGCCAAAAGAAGGGGGCGAGAAGACAAATGA
AGAACCACCTAAACCTGAAACACCGAAATAG
 Primer design

Protein ID: 229586347
T4SS name [ID]VirB [480]
Gene symbolvirB6-4
Locus tagRAF_ORF0134
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]143493..146168 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME5
KEGG IDraf:RAF_ORF0134
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.9e-21, Aligned region: 521..715
Protein Sequence: 891 a.a.     [Download]
>gi|229586347|ref|YP_002844848.1| VirB6 [Rickettsia africae ESF-5]
MKILKSLVLLVLFMAMPAKADDAFSWMSTSFGGLKSLFGCLEVPGFTSFQEGNIGINLSTAGLWQSTGNT
VQKGKLLKINWSTSGITFEPRKYLVLYRIDPRFSMPQVFIKTYNYSKLQFEALGFPRFVTDNNSETPGTI
PPDKNLDALSFTKMSDFVKYFNYSNGNSRIEVKAGDVVNISLVGKDNFFSPNTLKLPNTVDNILTQELDS
SIFAASALYTQSNLGDFDNRIIYSSAEQVCNMIDKERKSVCSGTGTATKYKNTDNGVIVGKPMITGAVQY
FMGLIKACPANAGINTSPACYYDQGRGMIIKVGGQVIKGQDQSFVNSGSTQSSFIYYQATSGGTMDFTSD
WQVSNMFSNSVLMSDWSRNFSNYASFVDYINKNDWSANFLYFGCYSMIVEIGNGANLINPDDQQNIKLEY
LITSDGTLPDPSVRGMPVDYNFATDAPQDGYLWLRVVNPNSNIQGVVSVNYANYTGTTWFSDIIYNGAIK
PITDQFRTFSQNFYIKLVKNSAVQNLAKTALTLYVTIFGLMFVTGALKLTAVEVITRICKIAIVAFLIRE
ESWSFFNTYFFSAFTDGIDFFVTNVVGVTSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIA
IITIYSLITYFRAILEVIIGYVIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQPTILLI
FFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTHLGIPLHFSFTLPFLPGIPFYVPDVPEISSSNILT
NNANTFLVLFTTALLFYSYCLMSYSLVTFVNIVVGMLTNVTPARISGNYQERSDPVGAVMQDIDSVTKPI
KKAAMAPSRVFKDKIIDQNYKARKPEVGGEFTNKFLAERNDVKKEEGEKKE
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|229586230|ref|NC_012633.1|:143493-146168 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAAATTCTTAAGAGTTTAGTTTTATTAGTTTTGTTTATGGCGATGCCAGCTAAAGCCGATGATGCTT
TTTCATGGATGTCAACCAGCTTTGGCGGGTTAAAAAGCTTATTCGGTTGTTTAGAAGTGCCTGGATTTAC
AAGTTTTCAAGAGGGTAATATAGGAATTAATTTATCTACAGCCGGACTTTGGCAATCAACAGGTAATACT
GTTCAGAAAGGTAAATTGTTAAAAATAAATTGGTCTACTTCAGGTATTACTTTTGAACCTAGAAAATATC
TAGTATTATATAGAATTGATCCAAGGTTTAGTATGCCGCAAGTTTTCATTAAAACTTATAATTATTCTAA
ATTACAATTTGAAGCTTTAGGATTTCCTCGTTTTGTTACGGACAATAACAGTGAAACACCGGGGACTATA
CCGCCTGATAAAAACCTTGATGCACTTTCATTTACTAAAATGTCTGATTTTGTTAAATATTTTAACTATT
CTAACGGTAATTCGAGAATTGAAGTTAAGGCCGGCGATGTAGTAAATATTAGTTTAGTTGGTAAAGATAA
TTTTTTTAGCCCTAATACTCTAAAACTTCCTAATACCGTAGATAATATTTTAACACAGGAACTTGATAGC
TCGATATTCGCTGCTTCTGCACTTTATACTCAAAGTAACCTTGGAGATTTTGATAATAGAATAATTTACT
CTTCTGCAGAGCAGGTGTGTAATATGATAGATAAGGAAAGAAAAAGTGTATGTAGCGGCACGGGTACTGC
TACAAAGTATAAAAATACCGATAATGGAGTAATAGTCGGTAAGCCTATGATAACAGGAGCGGTACAGTAT
TTCATGGGCTTAATTAAGGCTTGTCCTGCTAATGCCGGTATAAATACTAGCCCTGCTTGCTATTACGATC
AAGGTAGAGGGATGATAATTAAAGTAGGCGGGCAGGTTATTAAGGGACAAGATCAGAGTTTTGTAAATTC
AGGCAGTACTCAAAGTAGTTTTATATATTATCAAGCCACTAGCGGTGGTACTATGGATTTTACTAGCGAT
TGGCAAGTTAGTAACATGTTTAGTAATTCAGTTTTAATGAGTGATTGGAGCCGAAATTTTTCAAATTATG
CTAGTTTTGTAGATTATATAAATAAGAATGATTGGTCAGCTAATTTTTTATATTTTGGTTGTTATTCGAT
GATTGTTGAAATAGGTAATGGGGCAAATTTAATTAATCCTGATGATCAACAAAATATAAAGTTAGAATAT
TTAATAACGTCTGATGGTACATTACCTGATCCATCTGTTCGTGGTATGCCGGTAGATTATAACTTTGCGA
CTGATGCCCCGCAAGATGGATATTTATGGTTAAGGGTGGTAAATCCTAATAGTAATATACAAGGGGTAGT
TAGTGTAAATTATGCTAATTATACCGGTACAACTTGGTTTTCTGATATAATATATAACGGTGCTATTAAA
CCTATTACCGATCAGTTTAGAACTTTTAGTCAAAACTTTTATATTAAGTTAGTTAAAAATTCTGCAGTGC
AGAATTTAGCTAAAACTGCATTAACCCTTTATGTTACTATATTTGGGCTAATGTTCGTTACAGGAGCATT
AAAATTAACTGCCGTAGAAGTAATAACACGTATATGCAAAATAGCTATAGTAGCTTTTTTAATTAGAGAA
GAAAGTTGGAGCTTCTTTAATACATACTTCTTTAGTGCATTTACTGACGGTATTGATTTCTTTGTAACTA
ACGTAGTAGGTGTTACAAGCTCTAGATCTAATATTTTTGGTTTTATTGATCCTATATTTGATAAATATAC
TAACGGTAGGATTTGGGGATTACTATTTATTGAATTATTACAAATACATAATGGTTTAGCATTTATCGCT
ATTATAACCATTTATTCACTTATTACTTATTTTAGAGCTATTTTAGAAGTTATAATAGGTTATGTGATTG
CATTCATAGGGGTAACTGTTATGATTTCATTGGCACCGTTTTTTATAATATTAATGTTATTTGAAAAAAC
TAAAAGTTTATTTGATAATTGGATATCGACATTGCTTAGCTATGTAGTGCAGCCGACAATATTATTGATT
TTCTTTTTATTGATAGATCAGGTTTTATCTGAGCAGCTTTTAAAAGTGGTAGTTAGAGCCTGTTGGGATA
CTCTTATACCAATAAAAATAGGGCTTGATTTAACACATCTTGGTATTCCACTTCATTTCTCTTTTACATT
ACCGTTCTTACCCGGAATACCTTTCTATGTACCGGATGTTCCAGAAATTAGTAGCTCGAATATTCTAACG
AACAATGCTAATACTTTCTTAGTATTATTTACTACGGCTTTATTATTTTATTCATATTGCTTGATGTCAT
ATAGTTTAGTAACTTTTGTAAATATAGTAGTTGGAATGCTTACAAATGTTACACCGGCACGAATATCAGG
AAATTATCAAGAACGTTCTGATCCTGTGGGAGCCGTTATGCAGGATATAGATTCAGTAACAAAACCGATT
AAAAAGGCTGCAATGGCTCCGTCTAGAGTTTTCAAAGACAAGATAATTGATCAAAATTATAAAGCTAGAA
AACCGGAAGTAGGTGGTGAATTTACAAATAAATTTCTTGCTGAGCGTAATGATGTGAAGAAAGAGGAAGG
AGAGAAGAAAGAATAA
 Primer design

Protein ID: 229586348
T4SS name [ID]VirB [480]
Gene symbolvirB6-5
Locus tagRAF_ORF0135
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]146321..149782 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME6
KEGG IDraf:RAF_ORF0135
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.6e-24, Aligned region: 293..482
Protein Sequence: 1153 a.a.     [Download]
>gi|229586348|ref|YP_002844849.1| VirB6 [Rickettsia africae ESF-5]
MNKNIFITLLISLLLLSGCTGDTCIDPDDFGFIKFNVSARYDPEEITSRQEGNQVAPWRDSAYKVNGYPL
TIMVRPWSYILGDKNTSGQLSAWCPWYGQKNNTTTLAAFCVKLQPCTFWDNTRLDMCTPNPANQNDAMIS
NAPCIMTNGVGLYFLIAAKNTDPNISPDSQSKPQGITQHLGEELTSGYEFYSTSSTGQFLEAGGINYQYK
GEDKSKYAQSPLYFKIIDKFYNDNSGQYRLVIKSGVTDTRPDPLQFLTDLIKGVLFGKDGIIKKTYQQII
DTSGYRMSVSAILTLYIMFTGFSFLIGNINLTHVELIVRILKVSIVSILLSTDKAWTFFHDYLFVFFIDG
VQQILQIINEASATGPGSQSLLGLLISPQTLSKLFSLLFVDWLGFIYIILYLIALYFIFFLIFKATIIYL
TALITIGMIIIMGPIFICFMLFNITRSLFENWLRQLISYALQPIILFTGIAFISMIIRTEIYSTLGFAVC
KHDFPNLGPINEIFGSFLEDIDPSLGHSIFYWWFPVPMKGGINNFHKANILVPKDHIIVDDSCKNDPDKC
KHCAAYECIDERYIELPFLDLVKDAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDTAMSTAQFIAGTS
GNLTEIQKVNQQSYESAAQQMNRPLNYVAKTVSAPVTSRVSAGKEQVRMFFAEKFENMMMGRLEKQALGS
SANKTVQNEVKRKYGIDSKDVKMNAITDYENGIAGLLKNLPKGNELKAKELSQMKFTQLRDKIAANKYGV
KDYTALSKEQKAELDKSLKDANLRELASDANFTRDYQDAYKNAHQEMSGRGVGLFGKNIGVLRSWQEIKH
RVDTKRKLKEEQRVGIGEKIYAGYTGIKRGALTAIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKL
KDDEKAREHEELQMHINKEALAAQADILSPEYLARLEKAGRHSDVEYYQELAQRKLIHEVHGRLFEEGEP
VMMGDRFMCEKATDSQMRDMIDNAHRKYAEFIDGDRYIRRQEHYDIMHEKAQENLEQTYKELKDHFKRDD
IKIEEMPALIAQKVKDTAEGAEIDQKITEELNNFNADVKNYEYSTEVLNKIEDRKQAITDEVNAQIDKIN
KYRENAKMQTYVKPIVNEGRKLRKLEDHLRNMK
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|229586230|ref|NC_012633.1|:146321-149782 Rickettsia africae ESF-5 chromosome, complete genome
ATGAACAAAAATATTTTTATTACATTATTAATATCGCTATTGCTGCTTTCCGGTTGTACCGGCGATACTT
GTATTGACCCTGATGATTTCGGTTTTATCAAATTCAATGTCTCTGCTAGATATGATCCGGAAGAAATTAC
TTCAAGACAGGAAGGTAATCAGGTAGCACCATGGCGTGATAGTGCTTATAAAGTAAACGGCTATCCTTTA
ACCATTATGGTAAGACCGTGGAGTTATATACTTGGCGATAAAAATACTTCAGGTCAGTTATCTGCATGGT
GTCCATGGTATGGTCAAAAAAATAACACAACTACTTTGGCTGCTTTTTGTGTTAAGCTACAACCGTGTAC
TTTTTGGGATAATACTAGACTTGATATGTGTACTCCTAATCCCGCAAATCAAAATGATGCAATGATTAGT
AATGCTCCATGTATAATGACAAACGGTGTCGGGCTTTATTTTCTTATTGCCGCTAAAAATACCGATCCCA
ATATTTCACCGGACTCACAGAGTAAACCGCAAGGTATAACTCAGCATTTAGGAGAGGAGCTTACTTCGGG
CTATGAATTTTATAGTACTAGTAGTACAGGACAATTCTTGGAAGCCGGCGGTATAAATTATCAATATAAA
GGTGAAGATAAGTCAAAATATGCTCAATCTCCTCTTTATTTTAAGATTATAGATAAATTTTATAATGATA
ATAGCGGGCAATATAGATTAGTAATAAAGTCTGGAGTTACTGATACTAGACCCGATCCGCTACAATTTTT
AACGGATTTAATAAAAGGAGTATTATTTGGTAAGGATGGGATTATAAAGAAAACTTATCAACAAATAATT
GATACGTCGGGTTATAGGATGAGTGTCTCGGCTATTTTAACTCTATACATAATGTTTACAGGTTTTTCCT
TTTTAATAGGTAATATAAACCTTACTCATGTCGAACTTATAGTTAGAATATTAAAAGTTAGTATAGTCTC
AATATTATTAAGTACTGATAAAGCTTGGACATTTTTTCATGATTATTTATTCGTATTTTTTATTGATGGG
GTTCAGCAAATACTGCAAATAATTAATGAAGCTTCGGCTACCGGTCCTGGTTCTCAAAGCTTGCTTGGGT
TACTTATTTCTCCTCAAACTTTATCTAAATTATTTTCTTTACTATTTGTTGATTGGCTTGGTTTTATATA
TATCATTCTATATTTAATAGCCTTATATTTTATTTTCTTTCTTATATTTAAAGCCACTATTATCTATCTA
ACCGCTCTTATAACTATCGGGATGATTATAATTATGGGACCGATATTTATTTGTTTCATGTTGTTTAATA
TAACTCGTTCGTTATTTGAGAATTGGTTAAGACAATTAATATCATATGCATTACAGCCTATAATTTTATT
TACCGGTATCGCTTTTATTTCAATGATCATCAGAACCGAAATATATTCAACGCTTGGTTTTGCAGTATGT
AAACATGATTTTCCTAATTTAGGTCCGATAAATGAAATATTCGGTAGCTTCCTTGAGGATATAGATCCAA
GCCTGGGTCATTCAATATTTTATTGGTGGTTTCCAGTACCGATGAAAGGCGGTATAAATAATTTCCACAA
AGCAAATATATTAGTTCCTAAAGATCATATAATAGTAGATGATTCTTGTAAGAATGACCCTGATAAATGT
AAGCATTGTGCTGCGTATGAGTGTATAGATGAACGCTATATTGAATTACCGTTTTTAGATTTAGTTAAAG
ATGCAAAAAGAATTAGTAATTTTATAAATGGGAAATTTGTCCAACTTGACGGGATATTACTAATTTTTGT
GTCTATTTATTTGCTAAGTAAATTTAACGATACTGCTATGTCAACGGCACAATTTATTGCTGGTACTTCA
GGTAATTTAACAGAAATACAAAAAGTTAATCAGCAATCTTATGAATCTGCAGCGCAACAAATGAATAGAC
CGCTAAATTATGTGGCTAAGACGGTAAGTGCACCTGTAACTAGCCGTGTAAGTGCAGGGAAAGAGCAAGT
TCGTATGTTTTTTGCCGAGAAATTTGAAAATATGATGATGGGAAGGCTTGAAAAGCAAGCTCTCGGTTCT
TCAGCAAATAAAACCGTACAAAATGAGGTTAAGAGAAAATACGGTATAGATTCTAAAGATGTAAAAATGA
ATGCTATTACGGATTATGAAAACGGTATTGCAGGATTATTAAAGAATTTACCTAAGGGGAATGAATTAAA
AGCAAAAGAACTATCGCAAATGAAGTTTACTCAGCTTCGAGATAAAATTGCTGCAAATAAATATGGAGTG
AAAGATTACACTGCTTTAAGTAAAGAACAAAAAGCTGAGCTTGATAAGTCATTAAAAGATGCTAACTTAC
GTGAACTCGCTAGCGATGCAAACTTTACTAGAGATTATCAAGATGCTTATAAAAATGCTCACCAAGAAAT
GTCCGGGCGAGGTGTTGGTCTGTTTGGTAAGAATATAGGAGTGCTTAGAAGTTGGCAAGAGATAAAGCAT
CGTGTTGATACAAAACGTAAATTAAAAGAAGAACAGCGTGTAGGTATAGGCGAAAAAATATATGCAGGTT
ATACAGGAATAAAAAGAGGAGCTTTAACTGCAATAGTCGGTAAAGATTTACGTGATGCTTATGAGGGTAA
TCTAACCAGTGCCGAATGGCATGATTTTGAATATAACGATCCAAGGCTTAGAACTTATAGCGAAAAATTA
AAAGATGATGAAAAAGCACGAGAACATGAAGAGCTCCAAATGCATATTAATAAGGAGGCGCTAGCTGCTC
AAGCAGATATATTATCACCGGAATATCTAGCAAGACTAGAAAAAGCAGGTAGACATAGTGATGTGGAATA
TTATCAAGAATTAGCTCAAAGAAAGCTTATTCATGAGGTGCATGGTAGGTTATTTGAGGAAGGTGAACCG
GTAATGATGGGCGACAGATTTATGTGTGAGAAAGCTACTGATTCTCAGATGCGCGATATGATAGATAACG
CTCATAGAAAATATGCAGAATTTATAGATGGAGATCGATATATTCGTCGCCAAGAGCATTATGATATTAT
GCACGAGAAAGCCCAGGAAAATTTAGAGCAAACTTATAAAGAGCTTAAAGATCATTTCAAAAGAGATGAT
ATCAAGATCGAAGAAATGCCGGCATTAATAGCACAAAAAGTTAAAGATACCGCCGAGGGAGCTGAAATAG
ACCAAAAGATTACAGAAGAGCTTAATAACTTTAATGCTGATGTTAAAAATTATGAATATAGTACTGAAGT
ATTAAATAAAATAGAGGATAGAAAGCAAGCCATTACCGATGAAGTCAATGCTCAGATCGATAAGATTAAT
AAATATAGAGAAAATGCCAAAATGCAAACCTATGTAAAGCCTATAGTAAACGAGGGTAGAAAGCTAAGAA
AATTAGAAGATCATTTAAGAAATATGAAGTAG
 Primer design