SecReT4
Protein ID: 229586346
T4SS name [ID]VirB [480]
Gene symbolvirB6-3
Locus tagRAF_ORF0133
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]140419..143319 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME4
KEGG IDraf:RAF_ORF0133
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-31, Aligned region: 605..844
Protein Sequence: 966 a.a.     [Download]
>gi|229586346|ref|YP_002844847.1| VirB6 [Rickettsia africae ESF-5]
MQGNLLKVLGVLAIVATLVCFIFAALGMIGAVKVGDSCYMRYASDGQGGADSITGTITLNANANYVNTTK
MLSDGTTLLVPDPTRYGEWLNTQVLVENSQPVNLQVVGQVSLCLAYIPKDNLQRTGAGSNLDDNGQMIPI
PRINDTNNPPVSLIMDAKNNEWRNIAELYANDRVLVSVSPNFANTDATVKDAFKGAEVTQDCSENKTTYN
PICGKYSVYSGKYVNACELKEKYWNCQVTWRCPNWYEQAGCDWGALGCIASCQKIPECTTKCMAWVNIMR
PAPENYLDDESFTFSWSDNTGKLFIDYSALQCSYNANIPPADQCPDRVHDRRTKDKDYIGGVHCTSGICS
DGDFQKNRRFWYTADGKGGKGPTGLIYQMNDAGSVSQALPSKLEFAKFVADTDQPPDYKDKDGKYLYKVI
YNIPFNSDIAKSYLQYRLWSPTSQDSSKNTGGYVLNIKQTKCYRENGNSFNDTFDDRGRVQYIIVKPSEN
PNTSGKTYSPQGISVDSEGKYSFNANEAGYIWMKILNDPGNNLRDYKDSEGSYKVHFSTSLKVGSFSIKV
MNPLLQLFKTKVQGAATSIFKNMVCYKANDSSSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQKELVI
RIAKIGVVSGLMNGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDAVMSKIFFSQT
FIAQLLALLSLGLSGIIYFIITFIAVCIVIITALRAVAVYIMAFMATCILIGIAPLFISFLLFDFTRYLF
DNWVRFTIRYMLEPVVMMAGIIVLTQLFTIYLDFVLGYSVCWKCALPIKIPFIGTILPIALLNVPIFCIN
WFAPWGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGRMVVKLTSAVGPSATEIGGKMSHDAGQKALS
SIGMDDKTRQGITGRAEARLKQRNKTLDQAEKNRKNTPKEGGEKTNEEPPKPETPK
 
Nucleotide Sequence: 2901 bp     [Download]
>gi|229586230|ref|NC_012633.1|:140419-143319 Rickettsia africae ESF-5 chromosome, complete genome
ATGCAGGGTAACTTATTAAAAGTTTTAGGAGTACTTGCTATAGTAGCAACGTTAGTTTGCTTTATTTTTG
CAGCACTTGGTATGATAGGAGCAGTAAAAGTCGGTGACAGCTGCTACATGAGATATGCATCGGACGGTCA
AGGAGGAGCGGATTCAATAACCGGTACTATAACCCTTAATGCTAATGCTAATTATGTAAACACTACTAAG
ATGTTGTCCGACGGCACGACTCTGCTTGTTCCTGATCCTACTCGTTACGGTGAATGGCTAAATACTCAGG
TGCTAGTAGAAAACAGCCAACCGGTGAATTTACAAGTGGTCGGTCAGGTTAGTTTGTGTTTAGCTTATAT
ACCGAAAGATAATTTACAACGTACAGGGGCTGGATCTAATTTAGACGATAACGGTCAAATGATCCCGATT
CCTCGTATTAACGATACAAATAATCCACCTGTCTCTCTAATAATGGATGCAAAAAATAATGAATGGCGTA
ATATTGCCGAATTATACGCCAATGATAGAGTTTTAGTTTCCGTATCTCCTAATTTTGCCAATACGGATGC
GACAGTTAAAGATGCTTTTAAAGGTGCTGAAGTTACGCAAGATTGTTCAGAGAATAAAACTACTTATAAT
CCAATTTGTGGAAAATATTCTGTTTATTCAGGTAAGTATGTCAATGCTTGCGAGTTAAAAGAGAAATATT
GGAATTGTCAAGTCACATGGAGGTGCCCTAACTGGTATGAGCAAGCAGGTTGCGACTGGGGAGCATTGGG
CTGTATTGCGTCTTGTCAAAAGATACCAGAATGTACAACGAAATGTATGGCTTGGGTTAATATAATGAGA
CCAGCACCAGAAAACTACCTAGATGATGAGAGTTTTACATTTTCGTGGTCTGACAACACAGGTAAATTAT
TTATCGACTATTCAGCCCTTCAATGTTCTTATAATGCTAATATTCCTCCAGCTGATCAATGTCCTGATCG
TGTTCACGATCGTCGTACAAAAGATAAAGATTATATTGGAGGTGTACATTGTACTTCGGGCATATGTAGC
GATGGAGATTTTCAAAAGAATCGGAGATTTTGGTATACGGCGGACGGTAAAGGAGGCAAAGGACCAACTG
GATTAATATATCAAATGAATGATGCGGGTTCTGTAAGTCAAGCTCTGCCTTCTAAGCTAGAATTTGCTAA
ATTTGTTGCAGATACAGATCAACCGCCTGACTATAAAGATAAAGACGGTAAATATTTATATAAAGTTATA
TATAATATACCTTTTAACAGTGATATTGCAAAAAGTTATTTACAATATAGGCTGTGGTCGCCTACCTCAC
AAGATAGTAGTAAGAATACGGGAGGATACGTTTTAAATATTAAACAGACTAAATGCTATAGAGAAAACGG
TAATAGTTTTAACGATACTTTTGATGATCGAGGACGAGTGCAATACATCATAGTAAAGCCTTCGGAAAAC
CCGAATACTAGCGGTAAAACCTATTCACCTCAAGGAATTAGCGTTGATAGTGAAGGTAAATATAGCTTTA
ACGCAAATGAGGCGGGTTATATATGGATGAAAATTCTAAATGATCCTGGTAATAATTTAAGGGACTATAA
AGATAGTGAAGGTAGCTATAAAGTACATTTCTCAACATCCTTAAAAGTAGGAAGTTTTTCTATTAAAGTA
ATGAATCCGTTACTTCAGTTATTTAAAACTAAAGTGCAAGGGGCTGCTACTTCTATTTTTAAAAATATGG
TATGTTATAAAGCTAATGATAGTTCGTCCTGTACTAACTTTTTTACCTATATTAAAGCAATTTTAATTCT
GTATGTGATGACTTACGGAGCAATGTTTTTACTTGGTTTTGCTAAGATAAACCAAAAAGAGCTAGTAATT
AGAATAGCAAAAATCGGGGTAGTTAGCGGACTGATGAACGGTAATACCTTTGAATTTTTCAATAACTATC
TTTTTGATGCAATTACCAATTTTTCAGACTCAATTATTGCTAATATGAGTGGATATAGTTTGTTTACTTC
TACTAATACTATTTCTAATCCTTTCATGTTTTTAGATGCAGTAATGAGTAAAATATTTTTTAGTCAAACC
TTTATCGCTCAATTACTTGCACTTCTTTCTCTTGGGCTTAGCGGTATTATATATTTTATAATTACTTTTA
TTGCGGTTTGTATAGTAATTATTACGGCGCTTAGAGCTGTTGCCGTTTATATTATGGCATTTATGGCAAC
TTGTATATTAATCGGTATAGCCCCTTTATTTATTAGTTTCTTATTATTTGATTTTACTAGGTATTTATTT
GATAATTGGGTGAGGTTTACGATCCGCTATATGCTGGAACCGGTAGTTATGATGGCAGGTATTATAGTGC
TAACACAACTATTTACCATTTATCTAGATTTTGTTTTAGGTTATAGCGTGTGTTGGAAATGTGCTTTACC
GATAAAAATTCCGTTTATCGGTACTATTTTACCTATTGCCTTGCTGAATGTACCTATCTTCTGTATTAAT
TGGTTTGCCCCTTGGGGAATGGATTATATGTCGGGTATGATGGGAGTAAATATGCAAAATATCGTAGCTC
TAGTTATTATTGCTTACGGTATGTACGGTTATGTCGAATTTTCAGGACGTATGGTAGTAAAATTAACTAG
TGCTGTTGGGCCTTCGGCTACTGAAATTGGTGGTAAAATGTCTCATGATGCAGGACAAAAAGCATTAAGT
TCAATAGGAATGGATGATAAAACAAGACAAGGTATTACCGGCAGAGCGGAAGCACGATTAAAACAACGCA
ATAAGACATTAGATCAGGCTGAGAAAAATAGGAAAAATACGCCAAAAGAAGGGGGCGAGAAGACAAATGA
AGAACCACCTAAACCTGAAACACCGAAATAG
 Primer design